DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and zgc:172053

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001104712.1 Gene:zgc:172053 / 100002541 ZFINID:ZDB-GENE-080219-25 Length:151 Species:Danio rerio


Alignment Length:154 Identity:41/154 - (26%)
Similarity:66/154 - (42%) Gaps:21/154 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLIALILECANAQ----TCPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLL 70
            ||::::....||.    .||..:|:.|.|||....|...|..|:::|:.|||.|..:.::.:...
Zfish     8 LLLSVMFSLGNAGIGTCQCPYGWSKFGVKCYRFISQSVTWATAEKNCQSLGANLASVHSKAENDF 72

  Fly    71 TTTFLKSMGLSFTQSW--HHSVWAGINCLGNRRTFLLARNGETVPYLNWVPLEPNNASPEEDCVG 133
            ..:.:.|   |.|:.|  .|.        |......|..:|..:.|.||...||||.: .|:|:.
Zfish    73 LLSLIPS---SSTRCWIGGHD--------GENEGRWLWTDGSVIDYNNWCATEPNNQN-VENCME 125

  Fly   134 FA-NYNGAFGYHDIECKVQFPYVC 156
            .. ..|..  ::|..|.....|:|
Zfish   126 MQWTVNRC--WNDQACSTSMGYMC 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 37/136 (27%)
zgc:172053NP_001104712.1 CLECT 26..147 CDD:214480 36/134 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5404
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.