DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and asgrl1

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001107113.1 Gene:asgrl1 / 100000463 ZFINID:ZDB-GENE-081105-120 Length:270 Species:Danio rerio


Alignment Length:175 Identity:37/175 - (21%)
Similarity:65/175 - (37%) Gaps:57/175 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LILECANAQTCPLPFSRVGNK--CYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLK 76
            |:::...|:..|...:.|..|  ||..|..:.||..|:.:|.:.|:.|:|:::    |....||.
Zfish   122 LVMQVPVAEQGPCQENWVFYKGSCYFQSTMKRNWKTAESNCIQKGSHLVVVND----LAELDFLS 182

  Fly    77 SM-----------------------GLSFTQSWHHSVWAGINCLGNRRTFLLARNGETVPYLNWV 118
            |:                       |..|:.:.||  |.    :|....:.:..||         
Zfish   183 SIVKLSDSYWIGLVEKEEGQWSWVDGTEFSATEHH--WD----VGQPDDWDVRVNG--------- 232

  Fly   119 PLEPNNASPEEDCVGFAN---YNGAFGYHDIECKVQFPYVCQREP 160
                      |||....:   .|....::|.:|.:.:||:|:..|
Zfish   233 ----------EDCGQLHSREIVNRRRMWNDADCTLSYPYICEGNP 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 33/160 (21%)
asgrl1NP_001107113.1 CLECT_DC-SIGN_like 134..264 CDD:153060 32/158 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585368
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000024
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.