Sequence 1: | NP_723294.1 | Gene: | Myo28B1 / 53515 | FlyBaseID: | FBgn0040299 | Length: | 2122 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_574090.6 | Gene: | Myo3a / 498806 | RGDID: | 1560083 | Length: | 268 | Species: | Rattus norvegicus |
Alignment Length: | 265 | Identity: | 56/265 - (21%) |
---|---|---|---|
Similarity: | 97/265 - (36%) | Gaps: | 69/265 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 995 GDTIRLPKSVPNNIDTSDFSYLKYAATYFGGGATAQHERKPLKKS---LLKHEHPIDEMASKAIW 1056
Fly 1057 LTILRFMGDLPDVVSSPTLHVFDNENLMSDLASLL-------NTSDSYKPRLFVRQSQRRIPKPL 1114
Fly 1115 ASGEKEAQEFYQHWLNVPTSHLEKIHFIIGHGIIKNS---------------------------- 1151
Fly 1152 ---LRDEILAQICKQLYLNPSRSSYSRGWLLLSLCLSCF------PPSKEFEPHLRSFMK---QG 1204
Fly 1205 TAQLQ 1209 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Myo28B1 | NP_723294.1 | MYSc | 62..737 | CDD:214580 | |
MYSc_Myo7 | 81..726 | CDD:276832 | |||
IQ | 765..785 | CDD:197470 | |||
DUF4355 | 827..>887 | CDD:290964 | |||
MyTH4 | 1031..1239 | CDD:295320 | 47/229 (21%) | ||
B41 | 1248..1429 | CDD:214604 | |||
FERM_N | 1248..>1288 | CDD:286467 | |||
FERM_B-lobe | 1342..1429 | CDD:271216 | |||
PH-like | 1454..1547 | CDD:302622 | |||
MyTH4 | 1674..1819 | CDD:214535 | |||
B41 | 1827..2032 | CDD:214604 | |||
FERM_N | 1829..>1877 | CDD:286467 | |||
FERM_M | 1936..2032 | CDD:278785 | |||
FERM_C2_MyoVII | 2028..2121 | CDD:270020 | |||
Myo3a | XP_574090.6 | PKc_like | 2..258 | CDD:419665 | 56/265 (21%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |