DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myo28B1 and Myo3a

DIOPT Version :9

Sequence 1:NP_723294.1 Gene:Myo28B1 / 53515 FlyBaseID:FBgn0040299 Length:2122 Species:Drosophila melanogaster
Sequence 2:XP_574090.6 Gene:Myo3a / 498806 RGDID:1560083 Length:268 Species:Rattus norvegicus


Alignment Length:265 Identity:56/265 - (21%)
Similarity:97/265 - (36%) Gaps:69/265 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   995 GDTIRLPKSVPNNIDTSDFSYLKYAATYFGGGATAQHERKPLKKS---LLKHEHPIDEMASKAIW 1056
            |.|| :..:.|:..||.:.:......||  |.......:|..:|:   :|...|.|||.....  
  Rat     6 GKTI-IFDNFPDPSDTWEITETIGKGTY--GKVFKVLNKKNGQKAAVKILDPIHDIDEEIEAE-- 65

  Fly  1057 LTILRFMGDLPDVVSSPTLHVFDNENLMSDLASLL-------NTSDSYKPRLFVRQSQRRIPKPL 1114
            ..|||.:.|.|:||....:: |..:.:..|...|:       :.:|..|.  |:::.:|.....:
  Rat    66 YNILRTLSDHPNVVRFYGIY-FKKDKINGDKLWLVLELCNGGSVTDLVKG--FLKRGERMSEPII 127

  Fly  1115 ASGEKEAQEFYQHWLNVPTSHLEKIHFIIGHGIIKNS---------------------------- 1151
            |....||....||..:..|.|.:    :.|:.|:..:                            
  Rat   128 AYILHEALMGLQHLHSNKTIHRD----VKGNNILLTTEGGVKLVDFGVSAQLSSTRHRLNTSVGT 188

  Fly  1152 ---LRDEILAQICKQLYLNPSRSSYSRGWLLLSLCLSCF------PPSKEFEPHLRSFMK---QG 1204
               :..|::|  |:| .|:.:..:....|   ||.::..      ||..|..| :|:..|   .|
  Rat   189 PFWMAPEVIA--CEQ-QLDTTYDARCDTW---SLGITAIELGDGDPPLAELHP-MRALFKIPRSG 246

  Fly  1205 TAQLQ 1209
            ..|:|
  Rat   247 DQQVQ 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myo28B1NP_723294.1 MYSc 62..737 CDD:214580
MYSc_Myo7 81..726 CDD:276832
IQ 765..785 CDD:197470
DUF4355 827..>887 CDD:290964
MyTH4 1031..1239 CDD:295320 47/229 (21%)
B41 1248..1429 CDD:214604
FERM_N 1248..>1288 CDD:286467
FERM_B-lobe 1342..1429 CDD:271216
PH-like 1454..1547 CDD:302622
MyTH4 1674..1819 CDD:214535
B41 1827..2032 CDD:214604
FERM_N 1829..>1877 CDD:286467
FERM_M 1936..2032 CDD:278785
FERM_C2_MyoVII 2028..2121 CDD:270020
Myo3aXP_574090.6 PKc_like 2..258 CDD:419665 56/265 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.