DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C2 and UF3GT

DIOPT Version :9

Sequence 1:NP_001260516.1 Gene:Ugt37C2 / 53513 FlyBaseID:FBgn0040262 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_200217.1 Gene:UF3GT / 835489 AraportID:AT5G54060 Length:468 Species:Arabidopsis thaliana


Alignment Length:494 Identity:108/494 - (21%)
Similarity:182/494 - (36%) Gaps:161/494 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LGLFSSHSPSHLII---------HMS----VAKALVKAGHNVT------VVSMLKPKVTHKDI-- 67
            :|:|.|:..|.:.|         ||:    ::..|.:.||.:.      .::.|:|...:.::  
plant     1 MGVFGSNESSSMSIVMYPWLAFGHMTPFLHLSNKLAEKGHKIVFLLPKKALNQLEPLNLYPNLIT 65

  Fly    68 -HLIVVPMKEEQERIMEDQMTEM--AGQKNSLVS--TMYRLLTSMDVMINAQAELLSDPRFQRIY 127
             |.|.:|           |:..:  ..:.||.|.  ..:.|..:||         .:.|..:.|:
plant    66 FHTISIP-----------QVKGLPPGAETNSDVPFFLTHLLAVAMD---------QTRPEVETIF 110

  Fly   128 ET-KFDLMIL--GYFINDFQLGVAHKLKVPVIINWMSAP------VPAIDKYTGNPSELSYVPLM 183
            .| |.||:..  .::|.:....:..|   .|..|.:||.      ||:.::...:..|:|...| 
plant   111 RTIKPDLVFYDSAHWIPEIAKPIGAK---TVCFNIVSAASIALSLVPSAEREVIDGKEMSGEEL- 171

  Fly   184 GTVATQPMGF-----LKRTENALKSLLF-----EFIFVVFDYKLTRIYNDVFPEQDMPTLKELRK 238
               |..|:|:     :.|...| |||.|     |.|...||.|:|.:.|     .|...::..|:
plant   172 ---AKTPLGYPSSKVVLRPHEA-KSLSFVWRKHEAIGSFFDGKVTAMRN-----CDAIAIRTCRE 227

  Fly   239 N-------ISMAFVGSHLISEGPIRPLVPALIEIGGIQVKDKPDPLPKDID----QFISNAKQGA 292
            .       ||..: ...:...||:.|         |.|      |....:|    ::::....|:
plant   228 TEGKFCDYISRQY-SKPVYLTGPVLP---------GSQ------PNQPSLDPQWAEWLAKFNHGS 276

  Fly   293 -VFLSLGSNV--------------KSSTVRPEIVQI--------IFKVLSE-LKENVIWKWEDLE 333
             ||.:.||..              ..||..|.:|.|        :.:.|.| .||.|        
plant   277 VVFCAFGSQPVVNKIDQFQELCLGLESTGFPFLVAIKPPSGVSTVEEALPEGFKERV-------- 333

  Fly   334 NTPGNSSNILYKNWLPQDDILAHPNTKLFITHAGKGGITEAQYHGVPMVALPIFGDQPGNAALM- 397
                ....:::..|:.|..:|.||:...|::|.|.|.:.|:......:|.:|..|:|..||.|| 
plant   334 ----QGRGVVFGGWIQQPLVLNHPSVGCFVSHCGFGSMWESLMSDCQIVLVPQHGEQILNARLMT 394

  Fly   398 -----------EKSGYGLALDLLSITEDSLRDALKEVLE 425
                       ||.|:        .:..||.:|:|.|:|
plant   395 EEMEVAVEVEREKKGW--------FSRQSLENAVKSVME 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C2NP_001260516.1 egt 1..467 CDD:223071 108/494 (22%)
UDPGT 33..515 CDD:278624 105/485 (22%)
UF3GTNP_200217.1 Glycosyltransferase_GTB-type 10..462 CDD:415824 105/485 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.