DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C2 and AT5G38010

DIOPT Version :9

Sequence 1:NP_001260516.1 Gene:Ugt37C2 / 53513 FlyBaseID:FBgn0040262 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_198617.1 Gene:AT5G38010 / 833780 AraportID:AT5G38010 Length:453 Species:Arabidopsis thaliana


Alignment Length:440 Identity:88/440 - (20%)
Similarity:150/440 - (34%) Gaps:132/440 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LFSSHSPSHLIIHMSVAKALVKAGHNVTVV----SMLKPKVTHKDIHLIVVPMKEEQERIMEDQM 86
            |..:.:..|:...|.:|:||...|.::||.    :.|||.....|...|.:|           :.
plant    13 LIPAPAQGHISPMMQLARALHLKGFSITVAQTKFNYLKPSKDLADFQFITIP-----------ES 66

  Fly    87 TEMAGQKNSLVSTMYRLLTSMDVMINAQAE----------LLSDPRFQRIYETKFDLMILGYFIN 141
            ...:..||  :..::.||     .:|.:.|          ||..   |.|.|.:...:|...|:.
plant    67 LPASDLKN--LGPVWFLL-----KLNKECEFSFKECLGQLLLQK---QLIPEEEIACVIYDEFMY 121

  Fly   142 DFQLGVAHKLKVPVII----NWMS----------------AP-----------VPAID--KYTGN 173
             |....|.:..:|.:|    |..:                ||           ||.:.  :|...
plant   122 -FAEAAAKEFNLPKVIFSTENATAFACRSAMCKLYAKDGLAPLKEGCGREEELVPKLHPLRYKDL 185

  Fly   174 PSELSYVPLMGTVATQPMGFLKRTENALKSLLFEFIFVVFDYKLTRIYNDVFPEQDMPTLKELRK 238
            |:. ::.|:..:|........|.|.:|:                  |.|.| ...::.:|:.|::
plant   186 PTS-AFAPVEASVEVFKSSCDKGTASAM------------------IINTV-RCLEISSLEWLQQ 230

  Fly   239 NISMAF--VGS-HLISEGPIRPLVPALIEIGGIQVKDKPDPLPKDIDQFISNAKQGAVFLSLGSN 300
            .:.:..  :|. |::|..|...|:               |.....||..........:::||||.
plant   231 ELKIPIYPIGPLHMVSSAPPTSLL---------------DENESCIDWLNKQKPSSVIYISLGSF 280

  Fly   301 VKSSTVRPEIVQIIFKVLSELKENVIWKWEDLENTPGNSSNILYKN-----------------WL 348
            ....|  .|::::...::|. .::.:|...     ||:.......|                 |.
plant   281 TLLET--KEVLEMASGLVSS-NQHFLWVIR-----PGSILGSELTNEELLSMMEIPDRGYIVKWA 337

  Fly   349 PQDDILAHPNTKLFITHAGKGGITEAQYHGVPMVALPIFGDQPGNAALME 398
            ||..:|||.....|.:|.|.....|:...||||:..|...||..||..:|
plant   338 PQKQVLAHSAVGAFWSHCGWNSTLESMGEGVPMICRPFTTDQKVNARYVE 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C2NP_001260516.1 egt 1..467 CDD:223071 88/440 (20%)
UDPGT 33..515 CDD:278624 87/433 (20%)
AT5G38010NP_198617.1 Glycosyltransferase_GTB_type 1..450 CDD:299143 88/440 (20%)
YjiC 8..433 CDD:224732 88/440 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.