DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C2 and AT5G37950

DIOPT Version :9

Sequence 1:NP_001260516.1 Gene:Ugt37C2 / 53513 FlyBaseID:FBgn0040262 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_198611.1 Gene:AT5G37950 / 833774 AraportID:AT5G37950 Length:351 Species:Arabidopsis thaliana


Alignment Length:362 Identity:64/362 - (17%)
Similarity:119/362 - (32%) Gaps:136/362 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 IYETKFDLMILGYFINDFQLGVAHKLKVPVIINWMSAPVPAIDKYTGNP----------SELSYV 180
            :.:|||:.:.....:.|||.     :.:|       ..:||.|..|..|          .|:|:.
plant    17 VAQTKFNYLNPSKDLADFQF-----ITIP-------ESLPASDLKTLGPIWFIIKLNKECEISFK 69

  Fly   181 PLMGTVATQPMGFLKRTENALKSLLF-EFIF-------------VVFDYK----------LTRIY 221
            ..:|.       ||.:.:..:..::: ||::             |:|..:          :.::|
plant    70 KCLGQ-------FLLQQQEEIACVIYDEFMYFAEAAAKEFNLPKVIFSTENATAFACRSAMCKLY 127

  Fly   222 ---------------NDVFPE------QDMPT---------LKELRKNISMAFVGSHLIS----- 251
                           .::.||      :|:||         ::..:.:.......|.:|:     
plant   128 AKDGIAPLTEGCGREEELVPELHPLRYKDLPTSAFAPVEASVEVFKSSCEKGTASSMIINTVSCL 192

  Fly   252 ------------EGPIRPLVPALIEIGGIQVKDKP-----DPLPKDIDQFISNAKQGAVFLSLGS 299
                        :.||.|:.|..:      |...|     |.....||..........:::||||
plant   193 EISSLEWLQQELKIPIYPIGPLYM------VSSAPPTSLLDENESCIDWLNKQKPSSVIYISLGS 251

  Fly   300 NVKSSTVRPEIVQIIFKVLSELKENVIWKWEDLENTPGN------SSNILYK-----------NW 347
            .....|  .|::::...::|   .|..:.|   ...||:      |:..|:.           .|
plant   252 FTLLET--KEVLEMASGLVS---SNQYFLW---AIRPGSILGSELSNEELFSMMEIPDRGYIVKW 308

  Fly   348 LPQDDILAHPNTKLFITHAGKGGITEAQYHGVPMVAL 384
            ..|..:|||.....|.:|.|.....|:...|:|:|.|
plant   309 ATQKQVLAHAAVGAFWSHCGWNSTLESIGEGIPIVGL 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C2NP_001260516.1 egt 1..467 CDD:223071 64/362 (18%)
UDPGT 33..515 CDD:278624 64/362 (18%)
AT5G37950NP_198611.1 Glycosyltransferase_GTB_type 1..343 CDD:299143 62/358 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.