DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C2 and UGT78D3

DIOPT Version :9

Sequence 1:NP_001260516.1 Gene:Ugt37C2 / 53513 FlyBaseID:FBgn0040262 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_197205.1 Gene:UGT78D3 / 831566 AraportID:AT5G17030 Length:459 Species:Arabidopsis thaliana


Alignment Length:340 Identity:64/340 - (18%)
Similarity:119/340 - (35%) Gaps:90/340 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 WMSAPVPAIDK-------YTGNPSELSY------------VPLMGTVATQPMGFLK-----RTEN 199
            |::|...|.:.       |.|..:.|:.            |..:|....:.:||:.     |.::
plant   123 WLAAETAAAEMKASWVAYYGGGATSLTAHLYTDAIRENVGVKEVGERMEETIGFISGMEKIRVKD 187

  Fly   200 ALKSLLFEFIFVVFDYKL----------TRIYNDVFPEQDMPTLKELRKNISMAFVGSHLISEGP 254
            ..:.::|..:..||...|          |.::.:.|.|.|.....:.|....             
plant   188 TQEGVVFGNLDSVFSKTLHQMGLALPRATAVFINSFEELDPTFTNDFRSEFK------------- 239

  Fly   255 IRPLVPALIEIGGIQVKDKPDPL------PKDIDQFISNAKQGAV-FLSLGSNVKSSTVRPEIVQ 312
                  ..:.||.:.:...|...      |.....:|......:| :::.|   :.:|..|..:.
plant   240 ------RYLNIGPLALLSSPSQTSTLVHDPHGCLAWIEKRSTASVAYIAFG---RVATPPPVELV 295

  Fly   313 IIFKVLSELKENVIWKWEDLENT-------PGNSSNILYKNWLPQDDILAHPNTKLFITHAGKGG 370
            .|.:.|...|...:|..::::.|       .......:...|.||.::|.|....:|::|.|...
plant   296 AIAQGLESSKVPFVWSLQEMKMTHLPEGFLDRTREQGMVVPWAPQVELLNHEAMGVFVSHGGWNS 360

  Fly   371 ITEAQYHGVPMVALPIFGDQPGNAALME---------------KSGYGLALDLLSITEDSLRDAL 420
            :.|:...||||:..|||||...||..:|               |.|:..:||.:.:.:|.     
plant   361 VLESVSAGVPMICRPIFGDHAINARSVEAVWEIGVTISSGVFTKDGFEESLDRVLVQDDG----- 420

  Fly   421 KEVLENQKYKQAIGQ 435
            |::..|.|..:.:.|
plant   421 KKMKVNAKKLEELAQ 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C2NP_001260516.1 egt 1..467 CDD:223071 64/340 (19%)
UDPGT 33..515 CDD:278624 64/340 (19%)
UGT78D3NP_197205.1 Glycosyltransferase_GTB_type 6..458 CDD:299143 64/340 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.