DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C2 and UGT84A3

DIOPT Version :9

Sequence 1:NP_001260516.1 Gene:Ugt37C2 / 53513 FlyBaseID:FBgn0040262 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_193284.1 Gene:UGT84A3 / 827221 AraportID:AT4G15490 Length:479 Species:Arabidopsis thaliana


Alignment Length:339 Identity:78/339 - (23%)
Similarity:127/339 - (37%) Gaps:95/339 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 VAHKLKVPVIINW---------------------------MSAPVPAID--KYTGNPSEL----S 178
            ||.:|.:|..:.|                           :|..:|.:.  |:...||.|    .
plant   130 VAEELHIPSAVLWVQSCACLTAYYYYHHRLVKFPTKTEPDISVEIPCLPLLKHDEIPSFLHPSSP 194

  Fly   179 YVPLMGTVATQPMGFLKRTENALKSLLFEFIFVVFDYKLTRIYNDVFPEQDMPTLKELRKNISMA 243
            |......:..|    |||.||.....||                       :.|.:||.|:|...
plant   195 YTAFGDIILDQ----LKRFENHKSFYLF-----------------------IDTFRELEKDIMDH 232

  Fly   244 FVGSHLISEGPIRPLVP--ALIEIGGIQVK-DKPDPLPKDIDQFISNAKQGAVFLSLG--SNVKS 303
            .  |.|..:..|.|:.|  .:.:.....|| |..:|....::...|......|::|.|  :|:| 
plant   233 M--SQLCPQAIISPVGPLFKMAQTLSSDVKGDISEPASDCMEWLDSREPSSVVYISFGTIANLK- 294

  Fly   304 STVRPEIVQIIFKVLSELKENVIWKWE-DLENT---PGNSSNILYK---------NWLPQDDILA 355
               :.::.:|...|||. ..:|:|... .:|.|   |    ::|.:         .|.||:.:||
plant   295 ---QEQMEEIAHGVLSS-GLSVLWVVRPPMEGTFVEP----HVLPRELEEKGKIVEWCPQERVLA 351

  Fly   356 HPNTKLFITHAGKGGITEAQYHGVPMVALPIFGDQPGNAALME---KSGYGL---ALDLLSITED 414
            ||....|::|.|.....||...|||:|..|.:|||..:|..:.   |:|..|   |.:.:.::.:
plant   352 HPAIACFLSHCGWNSTMEALTAGVPVVCFPQWGDQVTDAVYLADVFKTGVRLGRGAAEEMIVSRE 416

  Fly   415 SLRDALKEVLENQK 428
            .:.:.|.|....:|
plant   417 VVAEKLLEATVGEK 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C2NP_001260516.1 egt 1..467 CDD:223071 78/339 (23%)
UDPGT 33..515 CDD:278624 78/339 (23%)
UGT84A3NP_193284.1 PLN02555 1..479 CDD:178170 78/339 (23%)
YjiC 8..450 CDD:224732 78/339 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.