DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C2 and UGT84A1

DIOPT Version :9

Sequence 1:NP_001260516.1 Gene:Ugt37C2 / 53513 FlyBaseID:FBgn0040262 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_193283.2 Gene:UGT84A1 / 827220 AraportID:AT4G15480 Length:490 Species:Arabidopsis thaliana


Alignment Length:238 Identity:53/238 - (22%)
Similarity:98/238 - (41%) Gaps:55/238 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 KNISMAF-------------VGSHLISEGPIRPLVPALIEIGGIQVKDKPDPLPKDIDQFI---- 285
            ||:|.:|             |..::.|..|::.:.| |.::......|....:.|..|:.:    
plant   219 KNLSKSFCVLIDSFDSLEQEVIDYMSSLCPVKTVGP-LFKVARTVTSDVSGDICKSTDKCLEWLD 282

  Fly   286 SNAKQGAVFLSLGSNVKSSTV----RPEIVQIIFKVLSELKENVIWKW----------------- 329
            |..|...|::|.|      ||    :.:|.:|...|   ||..:.:.|                 
plant   283 SRPKSSVVYISFG------TVAYLKQEQIEEIAHGV---LKSGLSFLWVIRPPPHDLKVETHVLP 338

  Fly   330 EDLENTPGNSSNILYKNWLPQDDILAHPNTKLFITHAGKGGITEAQYHGVPMVALPIFGDQPGNA 394
            ::|:.:......::. :|.||:.:|:||:...|:||.|.....|:...|||:|..|.:|||..:|
plant   339 QELKESSAKGKGMIV-DWCPQEQVLSHPSVACFVTHCGWNSTMESLSSGVPVVCCPQWGDQVTDA 402

  Fly   395 ALM---EKSGYGL---ALDLLSITEDSLRDALKEVLENQKYKQ 431
            ..:   .|:|..|   |.:...:..:.:.:.|.|....:|.::
plant   403 VYLIDVFKTGVRLGRGATEERVVPREEVAEKLLEATVGEKAEE 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C2NP_001260516.1 egt 1..467 CDD:223071 53/238 (22%)
UDPGT 33..515 CDD:278624 53/238 (22%)
UGT84A1NP_193283.2 PLN02555 17..490 CDD:178170 53/238 (22%)
YjiC 19..477 CDD:224732 53/238 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.