DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C2 and AT3G55710

DIOPT Version :9

Sequence 1:NP_001260516.1 Gene:Ugt37C2 / 53513 FlyBaseID:FBgn0040262 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_191130.1 Gene:AT3G55710 / 824737 AraportID:AT3G55710 Length:464 Species:Arabidopsis thaliana


Alignment Length:321 Identity:70/321 - (21%)
Similarity:111/321 - (34%) Gaps:112/321 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 YTGNP--SELSYVPLMGT-------------VATQPMGFLKRTENALKSLLFEFIFVVFDYKLTR 219
            ||..|  .:..|:|:.|:             |...|:...|..|.                 |.|
plant   146 YTAFPLLIDKGYLPIQGSRLDELVTELPPLKVKDLPVIKTKEPEG-----------------LNR 193

  Fly   220 IYNDV--------------FPEQDMPTLKELRKNISMAFVGSHLISEGPIRPLVPALIEIGGIQV 270
            |.||:              |.:.:..:|.:.|..:.:           |:.|:.|  .......:
plant   194 ILNDMVEGAKLSSGVVWNTFEDLERHSLMDCRSKLQV-----------PLFPIGP--FHKHRTDL 245

  Fly   271 KDKPDPLPKDIDQFISN-----AKQGAVFLSLGSNVKSSTVRPEIVQIIFKVLSELKEN----VI 326
            ..||....||.|:.:::     |.|..|::|.||                  |:.::||    :.
plant   246 PPKPKNKDKDDDEILTDWLNKQAPQSVVYVSFGS------------------LAAIEENEFFEIA 292

  Fly   327 W---------KW----------EDLENTP-GNSSNILYK----NWLPQDDILAHPNTKLFITHAG 367
            |         .|          |.||:.| |...||.::    .|:.|.:.||||....|.||.|
plant   293 WGLRNSELPFLWVVRPGMVRGTEWLESLPCGFLENIGHQGKIVKWVNQLETLAHPAVGAFWTHCG 357

  Fly   368 KGGITEAQYHGVPMVALPIFGDQPGNAA-LMEKSGYGLALDLLSITEDSLRDALKEV-LEN 426
            .....|:...||||:..|.|.||..||. :::....|:.|:...:....:...:..| :||
plant   358 WNSTIESICEGVPMICTPCFSDQHVNARYIVDVWRVGMMLERCKMERTEIEKVVTSVMMEN 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C2NP_001260516.1 egt 1..467 CDD:223071 70/321 (22%)
UDPGT 33..515 CDD:278624 70/321 (22%)
AT3G55710NP_191130.1 Glycosyltransferase_GTB_type 1..454 CDD:299143 70/321 (22%)
YjiC 7..421 CDD:224732 70/321 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.