DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C2 and AT3G46700

DIOPT Version :9

Sequence 1:NP_001260516.1 Gene:Ugt37C2 / 53513 FlyBaseID:FBgn0040262 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_190254.2 Gene:AT3G46700 / 823823 AraportID:AT3G46700 Length:447 Species:Arabidopsis thaliana


Alignment Length:437 Identity:84/437 - (19%)
Similarity:151/437 - (34%) Gaps:150/437 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 HLIIHMSVAKALVKAGHNVTVVSMLKPKVTHKDIHLIVVPMKEEQERIMEDQMTEMAGQKNSLVS 98
            |....|.:.:||:..|.:                  |:||.                |:.|.:.|
plant    20 HFTPMMQLGQALILKGFS------------------IIVPQ----------------GEFNRVNS 50

  Fly    99 TM----YRLLTSMDVMINAQAELLSDPRFQRIYETKF-------------DLMILGYFINDFQL- 145
            :.    ::.:|..|..:.|...:.|..:..:|.|..|             |:..:.|  ::|.. 
plant    51 SQKFPGFQFITIPDSELEANGPVGSLTQLNKIMEASFKDCIRQLLKQQGNDIACIIY--DEFMYF 113

  Fly   146 --GVAHKLKVP---------------VIINWMSAPVPAID--------KYTGNPSELSYVPLMGT 185
              .||.:||:|               .:::.::|....||        |...|...|.|..|...
plant   114 CGAVAEELKLPNFIFSTQTATHKVCCNVLSKLNAKKYLIDMEEHDVQNKVVENMHPLRYKDLPTA 178

  Fly   186 VATQPMGFL--------KRTENALKSLLFEFIFVVFDYKLTRIYNDVFPEQDMPTLKELRKNISM 242
            ...:...||        |||.:|   ::...:..:....|||:..::                  
plant   179 TFGELEPFLELCRDVVNKRTASA---VIINTVTCLESSSLTRLQQEL------------------ 222

  Fly   243 AFVGSHLISEGPIRPLVPALIEIGGIQVKDKP---DPLPKD---IDQFISNAKQGAVFLSLGSNV 301
                     :.|:.||       |.:.:.|..   ..|.:|   ::.......:..:::||||.|
plant   223 ---------QIPVYPL-------GPLHITDSSTGFTVLQEDRSCVEWLNKQKPRSVIYISLGSMV 271

  Fly   302 KSSTVRPEIVQIIFKVLSELKENVIWKW----------EDLENTPGNSSNILYK-----NWLPQD 351
            ...|  .|::::.:.:|:   .|..:.|          |.:|:.|...|.::.:     .|.||.
plant   272 LMET--KEMLEMAWGMLN---SNQPFLWVIRPGSVSGSEGIESLPEEVSKMVLEKGYIVKWAPQI 331

  Fly   352 DILAHPNTKLFITHAGKGGITEAQYHGVPMVALPIFGDQPGNAALME 398
            ::|.||:...|.:|.|.....|:...||||:..|..|:|..||..:|
plant   332 EVLGHPSVGGFWSHCGWNSTLESIVEGVPMICRPYQGEQMLNAIYLE 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C2NP_001260516.1 egt 1..467 CDD:223071 84/437 (19%)
UDPGT 33..515 CDD:278624 84/437 (19%)
AT3G46700NP_190254.2 Glycosyltransferase_GTB_type 1..446 CDD:299143 84/437 (19%)
YjiC 7..426 CDD:224732 84/437 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.