DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C2 and AT3G46680

DIOPT Version :9

Sequence 1:NP_001260516.1 Gene:Ugt37C2 / 53513 FlyBaseID:FBgn0040262 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_190252.1 Gene:AT3G46680 / 823821 AraportID:AT3G46680 Length:449 Species:Arabidopsis thaliana


Alignment Length:464 Identity:100/464 - (21%)
Similarity:164/464 - (35%) Gaps:123/464 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 HLIIHMSVAKALVKAGHNVTVVSMLKPKVTHKD----IHLIVVPMKEEQERIMEDQMTEMAGQKN 94
            |:...|.:..||...|.::|||.....||:...    ...:.:|..|.    :.:.:.|..|...
plant    20 HVTPMMQLGTALNMKGFSITVVEGQFNKVSSSQNFPGFQFVTIPDTES----LPESVLERLGPVE 80

  Fly    95 SLVSTMYRLLTSMDVMINAQAEL-LSDPRFQRIYETKFDLMILGYFINDFQLGVAHK-LKVPVII 157
            .|..            ||..:|. ..|...|.:.:...|:..:.|....:..|.|.| ..:|.:|
plant    81 FLFE------------INKTSEASFKDCIRQSLLQQGNDIACIIYDEYMYFCGAAAKEFNLPSVI 133

  Fly   158 -------NWMSAPV---------------PAI-DKYTGNPSELSYVPLMGTVATQPMGFLKRTEN 199
                   |.:|..|               |.: :....|...|.|..|    .|..:|.|.|   
plant   134 FSTQSATNQVSRCVLRKLSAEKFLVDMEDPEVQETLVENLHPLRYKDL----PTSGVGPLDR--- 191

  Fly   200 ALKSLLFEFIFVVFDYKLTR--IYNDVFPEQDMPTLKELRKNISMAFVGSHLISEGPIRPLVPA- 261
                 |||....:.:.:...  |.|.| ...:..:||.|:..:     |..:.:.||:...|.| 
plant   192 -----LFELCREIVNKRTASAVIINTV-RCLESSSLKRLQHEL-----GIPVYALGPLHITVSAA 245

  Fly   262 --LIEIGGIQV----KDKPDPLPKDIDQFISNAKQGAVFLSLGSNVKSSTVRPEIVQIIFKVLSE 320
              |:|.....|    |.||               :..|::||||.|:..|  .|::::. :.|..
plant   246 SSLLEEDRSCVEWLNKQKP---------------RSVVYISLGSVVQMET--KEVLEMA-RGLFN 292

  Fly   321 LKENVIW----------KWEDLENTPGNSSNILYK-----NWLPQDDILAHPNTKLFITHAGKGG 370
            ..:..:|          :|  :|:.|.....::.:     .|.||.::|.||....|.:|.|...
plant   293 SNQPFLWVIRPGSIAGSEW--IESLPEEVIKMVSERGYIVKWAPQIEVLGHPAVGGFWSHCGWNS 355

  Fly   371 ITEAQYHGVPMVALPIFGDQPGNAALM--------------EKSGYGLALDLLSITED--SLRDA 419
            ..|:...||||:..|..|:|..||..:              |:.|...|:..|.:.|:  .:|:.
plant   356 TLESIVEGVPMICRPFHGEQKLNALCLESIWRIGFQVQGKVERGGVERAVKRLIVDEEGADMRER 420

  Fly   420 LKEVLENQK 428
            ...:.||.|
plant   421 ALVLKENLK 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C2NP_001260516.1 egt 1..467 CDD:223071 100/464 (22%)
UDPGT 33..515 CDD:278624 100/464 (22%)
AT3G46680NP_190252.1 Glycosyltransferase_GTB_type 1..449 CDD:299143 100/464 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.