DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C2 and AT2G28080

DIOPT Version :9

Sequence 1:NP_001260516.1 Gene:Ugt37C2 / 53513 FlyBaseID:FBgn0040262 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_180375.1 Gene:AT2G28080 / 817352 AraportID:AT2G28080 Length:482 Species:Arabidopsis thaliana


Alignment Length:259 Identity:55/259 - (21%)
Similarity:104/259 - (40%) Gaps:54/259 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 LSYVPLMGTVATQP---MGFLKRTENALKSLLFEFIFVVFD--YKLTRIYNDVFPEQDMPTLKEL 236
            :.|:|  |..|..|   ..:|:.|:.:  |::.:.||..|:  .|:..:..:...:.:..|:|.|
plant   186 IDYIP--GVAAINPKDTASYLQETDTS--SVVHQIIFKAFEDVKKVDFVLCNTIQQFEDKTIKAL 246

  Fly   237 RKNISMAFVGSHLISEGPIRPLVPALIEIGGIQVKDKPDPLPKDIDQFI-SNAKQGAVFLSLGSN 300
            ...|....:|          |::|...:.|.:......:   .|..|:: :..|...:::|.|| 
plant   247 NTKIPFYAIG----------PIIPFNNQTGSVTTSLWSE---SDCTQWLNTKPKSSVLYISFGS- 297

  Fly   301 VKSSTVRPEIVQIIFKVLSELKENVIWKW--------------EDLENTPGNSSNILYKNWLPQD 351
             .:...:.::|:|...:|.. |.|.:|..              |..|...|:...::  .|..|.
plant   298 -YAHVTKKDLVEIAHGILLS-KVNFVWVVRPDIVSSDETNPLPEGFETEAGDRGIVI--PWCCQM 358

  Fly   352 DILAHPNTKLFITHAGKGGITEAQYHGVPMVALPIFGDQPGNAALM------------EKSGYG 403
            .:|:|.:...|:||.|...|.|..:..||::..|:..||..|..|:            :||.:|
plant   359 TVLSHESVGGFLTHCGWNSILETIWCEVPVLCFPLLTDQVTNRKLVVDDWEIGINLCEDKSDFG 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C2NP_001260516.1 egt 1..467 CDD:223071 55/259 (21%)
UDPGT 33..515 CDD:278624 55/259 (21%)
AT2G28080NP_180375.1 Glycosyltransferase_GTB_type 22..468 CDD:299143 55/259 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.