DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C2 and UGT84B1

DIOPT Version :9

Sequence 1:NP_001260516.1 Gene:Ugt37C2 / 53513 FlyBaseID:FBgn0040262 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_179907.1 Gene:UGT84B1 / 816858 AraportID:AT2G23260 Length:456 Species:Arabidopsis thaliana


Alignment Length:265 Identity:71/265 - (26%)
Similarity:109/265 - (41%) Gaps:63/265 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 PIRPLV-PALIEIGGIQVKDKPDPLPKDIDQFISN----------AKQGAVFLSLGSNVKSSTVR 307
            ||.||| |.|:..|..:..|     .|::|...|:          |:...|::|.||.::  |:.
plant   227 PIGPLVSPFLLGDGEEETLD-----GKNLDFCKSDDCCMEWLDKQARSSVVYISFGSMLE--TLE 284

  Fly   308 PEIVQIIFKVL-------------SELKENVIWKWEDLENTPGNSSNILYKNWLPQDDILAHPNT 359
            .: |:.|.|.|             .|..:||....|.::...|     :...|.||:.||:|...
plant   285 NQ-VETIAKALKNRGLPFLWVIRPKEKAQNVAVLQEMVKEGQG-----VVLEWSPQEKILSHEAI 343

  Fly   360 KLFITHAGKGGITEAQYHGVPMVALPIFGDQPGNAALM-EKSGYGLALDLLSITEDSLRDALKEV 423
            ..|:||.|.....|....|||:||.|.:.|||.:|.|: :..|.|:.:     ..||:...|| |
plant   344 SCFVTHCGWNSTMETVVAGVPVVAYPSWTDQPIDARLLVDVFGIGVRM-----RNDSVDGELK-V 402

  Fly   424 LENQKYKQAI--GQFSTLYRDRPMTAKQSVVFWTEYILRHQGAPNLQSPSVHMNFIQLNNLDIYA 486
            .|.::..:|:  |..:...|.|....|:        :.|...||...|         ..|||::.
plant   403 EEVERCIEAVTEGPAAVDIRRRAAELKR--------VARLALAPGGSS---------TRNLDLFI 450

  Fly   487 LIVTI 491
            ..:||
plant   451 SDITI 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C2NP_001260516.1 egt 1..467 CDD:223071 65/239 (27%)
UDPGT 33..515 CDD:278624 71/265 (27%)
UGT84B1NP_179907.1 PLN02210 1..456 CDD:215127 71/265 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.