DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C2 and UGT84B2

DIOPT Version :9

Sequence 1:NP_001260516.1 Gene:Ugt37C2 / 53513 FlyBaseID:FBgn0040262 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_179906.1 Gene:UGT84B2 / 816857 AraportID:AT2G23250 Length:438 Species:Arabidopsis thaliana


Alignment Length:344 Identity:83/344 - (24%)
Similarity:131/344 - (38%) Gaps:71/344 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 IYETKFDLMILGYFINDFQLGVAHKLKVPVIINWMSA---------------PVPAIDKYTGNPS 175
            |.|.:||.:|...| ..:...||....:|..|.|:.|               |.|.::. .....
plant    86 IEEKRFDCIISVPF-TPWVPAVAAAHNIPCAILWIQACGAFSVYYRYYMKTNPFPDLED-LNQTV 148

  Fly   176 ELSYVPLMGTVATQPMGFLKRTENALKSLLFEFIFVVFDYK--LTRIYNDVFPE--QDMPTLKEL 236
            ||..:||: .|...|...|......:.:|:.||...:.|.|  |...:.::..|  :.|..||.:
plant   149 ELPALPLL-EVRDLPSLMLPSQGANVNTLMAEFADCLKDVKWVLVNSFYELESEIIESMSDLKPI 212

  Fly   237 RKNISMAFVGSHLISEGPIRPLVPALIEIGGIQVKDKPDPLPK-DIDQFI-----SNAKQGAVFL 295
            .                ||.|||...: :|    .|:...|.. .:|.:.     ..|:...|::
plant   213 I----------------PIGPLVSPFL-LG----NDEEKTLDMWKVDDYCMEWLDKQARSSVVYI 256

  Fly   296 SLGSNVKSSTVRPEIVQIIFKVLSELKENVIWKWEDLENTPGNSSNILYK----------NWLPQ 350
            |.||.:||...:.|.:....|     ...|.:.|.......|.:..:|.:          .|..|
plant   257 SFGSILKSLENQVETIATALK-----NRGVPFLWVIRPKEKGENVQVLQEMVKEGKGVVTEWGQQ 316

  Fly   351 DDILAHPNTKLFITHAGKGGITEAQYHGVPMVALPIFGDQPGNAALM-EKSGYGLALDLLSITED 414
            :.||:|.....||||.|.....|....|||:||.|.:.|||.:|.|: :..|.|:.:     ..|
plant   317 EKILSHMAISCFITHCGWNSTIETVVTGVPVVAYPTWIDQPLDARLLVDVFGIGVRM-----KND 376

  Fly   415 SLRDALKEVLENQKYKQAI 433
            ::...|| |.|.::..:|:
plant   377 AIDGELK-VAEVERCIEAV 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C2NP_001260516.1 egt 1..467 CDD:223071 83/344 (24%)
UDPGT 33..515 CDD:278624 83/344 (24%)
UGT84B2NP_179906.1 PLN02210 1..438 CDD:215127 83/344 (24%)
YjiC 8..420 CDD:224732 83/344 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2351
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.