DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C2 and UGT2B4

DIOPT Version :9

Sequence 1:NP_001260516.1 Gene:Ugt37C2 / 53513 FlyBaseID:FBgn0040262 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_066962.2 Gene:UGT2B4 / 7363 HGNCID:12553 Length:528 Species:Homo sapiens


Alignment Length:518 Identity:154/518 - (29%)
Similarity:268/518 - (51%) Gaps:55/518 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SHLIIHMSVAKALVKAGHNVTVV-------------SMLKPKV-----THKDIHLIVVPMKEEQE 79
            ||.:...::...||:.||.|||:             |.||.:|     |..:...|:..:.:...
Human    34 SHWMNIKTILDELVQRGHEVTVLASSASISFDPNSPSTLKFEVYPVSLTKTEFEDIIKQLVKRWA 98

  Fly    80 RIMEDQMTEMAGQKNSLVSTMYRLLTSM--DVMINAQAELLSDPRFQRIYETKFDLMILGYFIND 142
            .:.:|.......|...::.|...:|...  |::.|.:.       .:::.|::|| ::|...:..
Human    99 ELPKDTFWSYFSQVQEIMWTFNDILRKFCKDIVSNKKL-------MKKLQESRFD-VVLADAVFP 155

  Fly   143 FQLGVAHKLKVPVIINWMSAPVPAIDKYTGN---PSELSYVPLMGTVATQPMGFLKRTENALKSL 204
            |...:|..||:|.:.:...:|..||:|::|.   |.  ||||::.:..:..|.|::|.:|.:..|
Human   156 FGELLAELLKIPFVYSLRFSPGYAIEKHSGGLLFPP--SYVPVVMSELSDQMTFIERVKNMIYVL 218

  Fly   205 LFEFIFVVFDY-KLTRIYNDVFPEQDMPTLKELRKNISMAFVGSHLISEGPIRPLVPALIEIGGI 268
            .|||.|.:||. |..:.|::|....  .||.|......:..:.::...:.| .||:|.:..:||:
Human   219 YFEFWFQIFDMKKWDQFYSEVLGRP--TTLSETMAKADIWLIRNYWDFQFP-HPLLPNVEFVGGL 280

  Fly   269 QVKDKPDPLPKDIDQFI-SNAKQGAVFLSLGSNVKSSTVRPEIVQIIFKVLSELKENVIWKWE-D 331
            ..| ...||||::::|: |:.:.|.|..||||.|  |....|...:|...|:::.:.|:|::: :
Human   281 HCK-PAKPLPKEMEEFVQSSGENGVVVFSLGSMV--SNTSEERANVIASALAKIPQKVLWRFDGN 342

  Fly   332 LENTPGNSSNILYKNWLPQDDILAHPNTKLFITHAGKGGITEAQYHGVPMVALPIFGDQPGNAAL 396
            ..:|.|.::. ||| |:||:|:|.||.|:.||||.|..||.||.|||:|||.:|:|.|||.|.|.
Human   343 KPDTLGLNTR-LYK-WIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGVPLFADQPDNIAH 405

  Fly   397 MEKSGYGLALDLLSITEDSLRDALKEVLENQKYKQAIGQFSTLYRDRPMTAKQSVVFWTEYILRH 461
            |:..|..::||..:::...|.:|||.|:.:..||:...:.|.::.|:|:......|||.|:::||
Human   406 MKAKGAAVSLDFHTMSSTDLLNALKTVINDPLYKENAMKLSRIHHDQPVKPLDRAVFWIEFVMRH 470

  Fly   462 QGAPNLQSPSVHMNFIQLNNLDI--YALIVTILVLFVLLTRLVAKIVWNKFGGKAKISQTKKK 522
            :||.:|:..:..:.:.|.::||:  :.|.....|:|::...|..  ||       |..:|.||
Human   471 KGAKHLRVAAHDLTWFQYHSLDVTGFLLACVATVIFIITKCLFC--VW-------KFVRTGKK 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C2NP_001260516.1 egt 1..467 CDD:223071 140/459 (31%)
UDPGT 33..515 CDD:278624 150/509 (29%)
UGT2B4NP_066962.2 egt 8..512 CDD:223071 147/495 (30%)
UDPGT 24..524 CDD:278624 152/516 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150456
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.