DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C2 and UGT2B28

DIOPT Version :9

Sequence 1:NP_001260516.1 Gene:Ugt37C2 / 53513 FlyBaseID:FBgn0040262 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_444267.1 Gene:UGT2B28 / 54490 HGNCID:13479 Length:529 Species:Homo sapiens


Alignment Length:517 Identity:155/517 - (29%)
Similarity:266/517 - (51%) Gaps:60/517 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SHLIIHMSVAKALVKAGHNVTVV----SMLKPKVTHKDIHLIVVP---MKEEQERIMEDQMTEMA 90
            ||.:...::.|.||:.||.|||:    |:|........:.|.|.|   .|.|.|.|:..|:...:
Human    34 SHWMNMKTILKELVQRGHEVTVLASSASILFDPNDAFTLKLEVYPTSLTKTEFENIIMQQVKRWS 98

  Fly    91 G-QKNSL---VSTMYRLLTSM-DVMINAQAELLSDPR-FQRIYETKFDLMILGYFINDFQLG--V 147
            . ||:|.   .|....:|... |:..|...:::|:.: .:::.|::||::....|   |..|  :
Human    99 DIQKDSFWLYFSQEQEILWEFHDIFRNFCKDVVSNKKVMKKLQESRFDIIFADAF---FPCGELL 160

  Fly   148 AHKLKVPVIINWMSAPVPAIDKYTGN---PSELSYVPLMGTVATQPMGFLKRTENALKSLLFEFI 209
            |..|.:|.:.:....|...|::::|.   |.  ||:|::.:..:..|.|::|.:|.:..|.|:|.
Human   161 AALLNIPFVYSLCFTPGYTIERHSGGLIFPP--SYIPVVMSKLSDQMTFMERVKNMIYVLYFDFW 223

  Fly   210 FVVFDY-KLTRIYNDVF--PEQDMPTLKE----LRKNISMAFVGSHLISEGPIRPLVPALIEIGG 267
            |.:.|. |..:.|::|.  |.....|:.:    |.:| |.:|...|        |.:|.:..:||
Human   224 FQMCDMKKWDQFYSEVLGRPTTLFETMGKADIWLMRN-SWSFQFPH--------PFLPNIDFVGG 279

  Fly   268 IQVKDKPDPLPKDIDQFI-SNAKQGAVFLSLGSNVKSSTVRPEIVQIIFKVLSELKENVIWKWED 331
            :..| ...||||::::|: |:.:.|.|..||||.:.:.|.  |...:|...|:::.:.|:|::: 
Human   280 LHCK-PAKPLPKEMEEFVQSSGENGVVVFSLGSVISNMTA--ERANVIATALAKIPQKVLWRFD- 340

  Fly   332 LENTPGNSSNI------LYKNWLPQDDILAHPNTKLFITHAGKGGITEAQYHGVPMVALPIFGDQ 390
                 ||..:.      ||| |:||:|:|..|.|:.||||.|..||.||.|||:|||.:|:|.||
Human   341 -----GNKPDALGLNTRLYK-WIPQNDLLGLPKTRAFITHGGANGIYEAIYHGIPMVGIPLFWDQ 399

  Fly   391 PGNAALMEKSGYGLALDLLSITEDSLRDALKEVLENQKYKQAIGQFSTLYRDRPMTAKQSVVFWT 455
            |.|.|.|:..|..:.||..:::...|.:|||.|:.:..||:.:.:.|.:..|:|:......|||.
Human   400 PDNIAHMKAKGAAVRLDFHTMSSTDLLNALKTVINDPSYKENVMKLSIIQHDQPVKPLHRAVFWI 464

  Fly   456 EYILRHQGAPNLQSPSVHMNFIQLNNLDI--YALIVTILVLFVLLTRLVAKIVWNKFGGKAK 515
            |:::.|:||.:|:..:..:.:.|.::||:  :.|.....|:|| :|:......| ||..|.|
Human   465 EFVMCHKGAKHLRVAARDLTWFQYHSLDVIGFLLACVATVIFV-VTKFCLFCFW-KFARKGK 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C2NP_001260516.1 egt 1..467 CDD:223071 141/465 (30%)
UDPGT 33..515 CDD:278624 154/515 (30%)
UGT2B28NP_444267.1 UDPGT 24..525 CDD:278624 155/517 (30%)
egt <269..506 CDD:223071 84/246 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150519
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.