DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C2 and Ugt3a2

DIOPT Version :9

Sequence 1:NP_001260516.1 Gene:Ugt37C2 / 53513 FlyBaseID:FBgn0040262 Length:523 Species:Drosophila melanogaster
Sequence 2:XP_038959826.1 Gene:Ugt3a2 / 294793 RGDID:1564365 Length:454 Species:Rattus norvegicus


Alignment Length:451 Identity:122/451 - (27%)
Similarity:205/451 - (45%) Gaps:84/451 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 LLTSMDVMINAQAELLSDPRFQRI-YET--------------KFDLMI---LGYFINDFQLGVAH 149
            ||:..|:|     |.|.:..|..: :|:              :|.|.:   ||:.  ||:|    
  Rat    54 LLSRKDIM-----EFLKNANFDLVLFESVDYCSSLIVEKLGKQFVLFLAFQLGFM--DFEL---- 107

  Fly   150 KLKVPVIINWMSAPVPAIDKYTGNPSELSYVPLMGTVATQPMGFLKRTENALKSLLFEFIFVVFD 214
             .:||                      |||||:.|:..|..|.|..|.:|          |::| 
  Rat   108 -QRVP----------------------LSYVPVYGSGLTDQMDFWGRVKN----------FLMF- 138

  Fly   215 YKLTRIYNDV-----------FPEQDMPTLKELRKNISMAFVGSHLISEGPIRPLVPALIEIGGI 268
            :.|:|...::           |.|...|.|.:|.....:.||......|. .|||.|.::.:||:
  Rat   139 FDLSRKQREILSQYDSTIQEHFAEGSRPVLSDLLLKAELWFVNCDFAFEF-ARPLFPNIVYVGGL 202

  Fly   269 QVKDKP-DPLPKDIDQFISN-AKQGAVFLSLGSNVKSSTVRPEIVQIIFKVLSELKENVIWKWED 331
              .||| ..:|:|::.||:. ...|.|.::||: |.:.....||::.:....:.|.:.|||..:|
  Rat   203 --LDKPVQSIPQDLENFITQFGDSGFVLVALGT-VATKFQTKEIIKEMNNAFAHLPQGVIWACKD 264

  Fly   332 LENTPGN---SSNILYKNWLPQDDILAHPNTKLFITHAGKGGITEAQYHGVPMVALPIFGDQPGN 393
             .:.|.:   :.|:...:||||.|:||||:.:||:||.|...:.||..||||||.:..|.|||.|
  Rat   265 -SHWPKDVTLAPNVKIMDWLPQTDLLAHPSIRLFVTHGGMNSVNEAIQHGVPMVGILFFSDQPEN 328

  Fly   394 AALMEKSGYGLALDLLSITEDSLRDALKEVLENQKYKQAIGQFSTLYRDRPMTAKQSVVFWTEYI 458
            ...:|....|:::.:.::..::....:|||:|:::||.|......:....|:|..|.:..|.::|
  Rat   329 MIRVEAKTIGVSIQIQTLKAETFARTMKEVIEDKRYKSAAMASKIIRHSHPLTPSQRLEGWIDHI 393

  Fly   459 LRHQGAPNLQSPSVHMNFIQLNNLDIYALIVTILVLFVLLTRLVAKIVWNKFGGKAKISQT 519
            |:..||.:|:..:....:.:...||::..::.:.:..|.|...|...|.....|..|..||
  Rat   394 LQTGGAAHLKPYAFQQPWHEQYLLDVFLFLLGLTLGTVWLCVKVLGAVMRYLSGARKAKQT 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C2NP_001260516.1 egt 1..467 CDD:223071 111/397 (28%)
UDPGT 33..515 CDD:278624 119/445 (27%)
Ugt3a2XP_038959826.1 Glycosyltransferase_GTB-type 49..419 CDD:415824 113/414 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344171
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.