DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C2 and UGT2B11

DIOPT Version :9

Sequence 1:NP_001260516.1 Gene:Ugt37C2 / 53513 FlyBaseID:FBgn0040262 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_001064.1 Gene:UGT2B11 / 10720 HGNCID:12545 Length:529 Species:Homo sapiens


Alignment Length:522 Identity:147/522 - (28%)
Similarity:261/522 - (50%) Gaps:70/522 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SHLIIHMSVAKALVKAGHNVTVV-------------SMLKPKV-----THKDIHLIVVPMKEEQE 79
            ||.:...::.|.||:.||.|||:             |.||.:|     |..:...|::...:...
Human    34 SHWMNMKTILKELVQRGHEVTVLASSASILFDPNDASTLKFEVYPTSLTKTEFENIIMQQVKRWS 98

  Fly    80 RIMEDQMTEMAGQKNSLVSTMYRLLTSMDVMINAQAELLSDPR-FQRIYETKFDLMILGYFINDF 143
            .|.:|.......|:..::..:|      |:..|...:::|:.: .:::.|::||::.....   |
Human    99 DIRKDSFWLYFSQEQEILWELY------DIFRNFCKDVVSNKKVMKKLQESRFDIVFADAV---F 154

  Fly   144 QLG--VAHKLKVPVIINWMSAPVPAIDKYTGN---PSELSYVPLMGTVATQPMGFLKRTENALKS 203
            ..|  :|..|.:..:.:....|...|::::|.   |.  ||:|::.:..:..|.|::|.:|.:..
Human   155 PCGELLAALLNIRFVYSLRFTPGYTIERHSGGLIFPP--SYIPIVMSKLSDQMTFMERVKNMIYV 217

  Fly   204 LLFEFIFVVFDY-KLTRIYNDVF--PEQDMPTLKE----LRKNISMAFVGSHLISEGPIRPLVPA 261
            |.|:|.|.:.|. |..:.|::|.  |.....|:.:    |.:| |.:|...|        |.:|.
Human   218 LYFDFWFQMSDMKKWDQFYSEVLGRPTTLFETMGKADIWLMRN-SWSFQFPH--------PFLPN 273

  Fly   262 LIEIGGIQVKDKPDPLPKDIDQFI-SNAKQGAVFLSLGSNVKSSTVRPEIVQIIFKVLSELKENV 325
            :..:||...| ...||||::::|: |:.:.|.|..||||.:.:.|.  |...:|...|:::.:.|
Human   274 VDFVGGFHCK-PAKPLPKEMEEFVQSSGENGVVVFSLGSVISNMTA--ERANVIATALAKIPQKV 335

  Fly   326 IWKWEDLENTPGNSSNI------LYKNWLPQDDILAHPNTKLFITHAGKGGITEAQYHGVPMVAL 384
            :|:::      ||..:.      ||| |:||:|:|.||.|:.||||.|..||.||.|||:|||.:
Human   336 LWRFD------GNKPDALGLNTRLYK-WIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGI 393

  Fly   385 PIFGDQPGNAALMEKSGYGLALDLLSITEDSLRDALKEVLENQKYKQAIGQFSTLYRDRPMTAKQ 449
            |:|.|||.|.|.|:..|..:.||..:::...|.:|||.|:.:..||:.|.:.|.:..|:|:....
Human   394 PLFFDQPDNIAHMKAKGAAVRLDFNTMSSTDLLNALKTVINDPLYKENIMKLSRIQHDQPVKPLD 458

  Fly   450 SVVFWTEYILRHQGAPNLQSPSVHMNFIQLNNLDIYA-LIVTILVLFVLLTRLVAKIVWNKFGGK 513
            ..|||.|:::.|:||.:|:..:..:.:.|.::||:.. |:..:..:..::|:......| ||..|
Human   459 RAVFWIEFVMPHKGAKHLRVAAHDLTWFQYHSLDVIGFLLACVATVIFIITKFCLFCFW-KFARK 522

  Fly   514 AK 515
            .|
Human   523 GK 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C2NP_001260516.1 egt 1..467 CDD:223071 136/471 (29%)
UDPGT 33..515 CDD:278624 146/520 (28%)
UGT2B11NP_001064.1 UDPGT 24..525 CDD:278624 147/522 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150518
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.