DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37E1 and UGT89B1

DIOPT Version :9

Sequence 1:NP_652628.2 Gene:Ugt37E1 / 53512 FlyBaseID:FBgn0040261 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_177529.2 Gene:UGT89B1 / 843725 AraportID:AT1G73880 Length:473 Species:Arabidopsis thaliana


Alignment Length:447 Identity:88/447 - (19%)
Similarity:150/447 - (33%) Gaps:136/447 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SHVIVHMAVMKALADRGHNITVVTQMKPKLATHE---------NITVIIAPPTEERQRYIKEYMA 92
            :||::.     ....:||.|.::.      .||.         .|||::.|   :...::...::
plant    13 THVLIF-----PFPAQGHMIPLLD------FTHRLALRGGAALKITVLVTP---KNLPFLSPLLS 63

  Fly    93 EVSNEKPSFWETMVKAIVQSSNQLEGQYEFMTHPNVKEIYENPKIKFDLVFLGLMANTYQLGIAA 157
            .|.|.:|..                  ..|.:||::....||.:   ||...|.....:.||   
plant    64 AVVNIEPLI------------------LPFPSHPSIPSGVENVQ---DLPPSGFPLMIHALG--- 104

  Fly   158 KLKCPVIISWVGIPLPFMDTIVGNVNDPSYVPTVNVALN--AGQKTMDFGLRFVNFFKYAIM--C 218
            .|..| :|||:             .:.||  |.|.:..:  .|. |.:.|:...:|...|.:  |
plant   105 NLHAP-LISWI-------------TSHPS--PPVAIVSDFFLGW-TKNLGIPRFDFSPSAAITCC 152

  Fly   219 VFETV---LDYKMNQFYERAFANELEFPNYHEMK-RRVSLLFYNY-------------------- 259
            :..|:   :..|:|:..:....:..:.||..:.: .::|.|:.:|                    
plant   153 ILNTLWIEMPTKINEDDDNEILHFPKIPNCPKYRFDQISSLYRSYVHGDPAWEFIRDSFRDNVAS 217

  Fly   260 -------HSASEG----------------PIRPTVPQSIEIGGIQVKEQADPLPKELAKFLD-KA 300
                   .:|.||                .:.|.:|.|.:..|.......|    .:..:|| :.
plant   218 WGLVVNSFTAMEGVYLEHLKREMGHDRVWAVGPIIPLSGDNRGGPTSVSVD----HVMSWLDARE 278

  Fly   301 DEGAIFFSLGTNVNTNTFRPDTVDILYKVLSKLPQRVIWKWEDLKNKPGNASNIFFG-------- 357
            |...::...|:.|   ....:....|...|.|.....||..::...|.....||..|        
plant   279 DNHVVYVCFGSQV---VLTKEQTLALASGLEKSGVHFIWAVKEPVEKDSTRGNILDGFDDRVAGR 340

  Fly   358 -----NWLPQDDILAHPNTKLFITHAGKGGVAEAQYHGVPMVALPIFGDQQGNAEIM 409
                 .|.||..:|.|.....|:||.|...|.||...||.|:..|:..||..:|.::
plant   341 GLVIRGWAPQVAVLRHRAVGAFLTHCGWNSVVEAVVAGVLMLTWPMRADQYTDASLV 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37E1NP_652628.2 egt 7..475 CDD:223071 88/447 (20%)
YjiC 27..448 CDD:224732 88/447 (20%)
UGT89B1NP_177529.2 PLN02863 4..473 CDD:215465 88/447 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.