DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37E1 and UGT74B1

DIOPT Version :9

Sequence 1:NP_652628.2 Gene:Ugt37E1 / 53512 FlyBaseID:FBgn0040261 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_173820.1 Gene:UGT74B1 / 839022 AraportID:AT1G24100 Length:460 Species:Arabidopsis thaliana


Alignment Length:262 Identity:60/262 - (22%)
Similarity:104/262 - (39%) Gaps:73/262 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 EFPNYHEMKRRVSLLFYNYHSASE------------------GPIRPT------VPQSIEIGGIQ 281
            :||| ||   ....||.|.....|                  ||:.|:      :....:.|...
plant   197 QFPN-HE---NADWLFVNGFEGLEETQDCENGESDAMKATLIGPMIPSAYLDDRMEDDKDYGASL 257

  Fly   282 VKEQADPLPKELAKFLD-KADEGAIFFSLGT----------NVNTNTFRPDTVDILYKV----LS 331
            :|    |:.||..::|: |..:...|.|.|:          .| ....:...::.|:.:    ::
plant   258 LK----PISKECMEWLETKQAQSVAFVSFGSFGILFEKQLAEV-AIALQESDLNFLWVIKEAHIA 317

  Fly   332 KLPQRVIWKWEDLKNKPGNASNIFFGNWLPQDDILAHPNTKLFITHAGKGGVAEAQYHGVPMVAL 396
            |||:..:   |..|::      ....:|..|.::|||.:...|:||.|.....|....|||||.:
plant   318 KLPEGFV---ESTKDR------ALLVSWCNQLEVLAHESIGCFLTHCGWNSTLEGLSLGVPMVGV 373

  Fly   397 PIFGDQQGNA---EIMTKSGF------GRWLDILTMTEHELEQTIREVL---GNPAYRETIGKFS 449
            |.:.||..:|   |.:.|.|:      |   :::..:| ||.:.::.|:   .:...||:..|:.
plant   374 PQWSDQMNDAKFVEEVWKVGYRAKEEAG---EVIVKSE-ELVRCLKGVMEGESSVKIRESSKKWK 434

  Fly   450 TL 451
            .|
plant   435 DL 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37E1NP_652628.2 egt 7..475 CDD:223071 60/262 (23%)
YjiC 27..448 CDD:224732 58/257 (23%)
UGT74B1NP_173820.1 Glycosyltransferase_GTB-type 7..455 CDD:415824 60/262 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.