DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37E1 and UGT75B2

DIOPT Version :9

Sequence 1:NP_652628.2 Gene:Ugt37E1 / 53512 FlyBaseID:FBgn0040261 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_172044.1 Gene:UGT75B2 / 837055 AraportID:AT1G05530 Length:455 Species:Arabidopsis thaliana


Alignment Length:306 Identity:58/306 - (18%)
Similarity:106/306 - (34%) Gaps:72/306 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 PNVKEIYENPKIKFDLVFLGLMANTYQLGIAAKLKCPVIISWVGIPLPFMDTIVGNVND-PSYVP 189
            |:| .::..|...||:.:      .|..|..:..:.|        .||.::     :.| ||::.
plant   129 PSV-HLWIQPAFAFDIYY------NYSTGNNSVFEFP--------NLPSLE-----IRDLPSFLS 173

  Fly   190 TVNVALNAGQKTMDFGLRFVNFFKYAIMCVFETVLDYKMNQFYERAFANELEFPNYHEMKRRVSL 254
            ..|.                   ..|...|::.::|:...:...:...|     .:..::.....
plant   174 PSNT-------------------NKAAQAVYQELMDFLKEESNPKILVN-----TFDSLEPEFLT 214

  Fly   255 LFYNYHSASEGPIRPTVPQSIEIGGIQVKE-QADPLPKELAKFLD-KADEGAIFFSLGTNVNTNT 317
            ...|....:.||:   :|..|..|....|: ..|........:|| |.:...|:.|.||.|..: 
plant   215 AIPNIEMVAVGPL---LPAEIFTGSESGKDLSRDHQSSSYTLWLDSKTESSVIYVSFGTMVELS- 275

  Fly   318 FRPDTVDILYKVLSKLPQRVIWKWEDLKNKPGNASNI-------------------FFGNWLPQD 363
              ...::.|.:.|.:..:..:|...|..|:.......                   ...:|..|.
plant   276 --KKQIEELARALIEGGRPFLWVITDKLNREAKIEGEEETEIEKIAGFRHELEEVGMIVSWCSQI 338

  Fly   364 DILAHPNTKLFITHAGKGGVAEAQYHGVPMVALPIFGDQQGNAEIM 409
            ::|.|.....|:||.|.....|:...|||:||.|::.||..||:::
plant   339 EVLRHRAIGCFLTHCGWSSSLESLVLGVPVVAFPMWSDQPANAKLL 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37E1NP_652628.2 egt 7..475 CDD:223071 58/306 (19%)
YjiC 27..448 CDD:224732 58/306 (19%)
UGT75B2NP_172044.1 PLN02152 1..455 CDD:177813 58/306 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2351
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.