DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37E1 and AT5G65550

DIOPT Version :9

Sequence 1:NP_652628.2 Gene:Ugt37E1 / 53512 FlyBaseID:FBgn0040261 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_201358.1 Gene:AT5G65550 / 836681 AraportID:AT5G65550 Length:466 Species:Arabidopsis thaliana


Alignment Length:491 Identity:105/491 - (21%)
Similarity:196/491 - (39%) Gaps:114/491 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LGVFGTHSPSHVIVHMAVMKALADRGHNITVVTQMK-----PKLATHENITVIIAPPTEERQRYI 87
            :.||...:..|:|.::.:.|.:|.:||.::.::..:     |.:::..::. .::.|..:...::
plant    10 VAVFPWLALGHMIPYLQLSKLIARKGHTVSFISTARNISRLPNISSDLSVN-FVSLPLSQTVDHL 73

  Fly    88 KEYMAEVSNEKPSFWETMVKAIVQSSNQL-EGQYEFM--THPNVKEIYENPKIKFDLVFLGLMAN 149
            .| .||.:.:.|   ||.:..:.::.:.| |...||:  :.||        .|.:|::...:...
plant    74 PE-NAEATTDVP---ETHIAYLKKAFDGLSEAFTEFLEASKPN--------WIVYDILHHWVPPI 126

  Fly   150 TYQLGIAAKLKC-----PVIISWVGIPLPFM-----------DTIVGNVNDPSYVP-TVNVA--L 195
            ..:||:...:.|     .:||  :|.|...|           |.||    .|.:|| ..|:.  |
plant   127 AEKLGVRRAIFCTFNAASIII--IGGPASVMIQGHDPRKTAEDLIV----PPPWVPFETNIVYRL 185

  Fly   196 NAGQKTMDFGLRFVNFFKYAIMCVFETVLDYKMNQFYERAFANELEFPNYHEMKRRVSLLFYNYH 260
            ...::.|::....|...:....|  ...|.|..::........||| |.:      :.||     
plant   186 FEAKRIMEYPTAGVTGVELNDNC--RLGLAYVGSEVIVIRSCMELE-PEW------IQLL----- 236

  Fly   261 SASEGPIRPTVPQSIEIGGIQVKEQADPLPK----ELAKFLDKAD-EGAIFFSLGTNVNTNTFRP 320
            |..:|  :|.:|    ||.:......|...:    ::.::||:.. :..::.:|||.|   |...
plant   237 SKLQG--KPVIP----IGLLPATPMDDADDEGTWLDIREWLDRHQAKSVVYVALGTEV---TISN 292

  Fly   321 DTVDILYK--VLSKLPQRVIWKW---------------EDLKNKPGNASNIFFGNWLPQDDILAH 368
            :.:..|..  .|.:||  ..|..               |.:|.:     .:.:..|:||..||:|
plant   293 EEIQGLAHGLELCRLP--FFWTLRKRTRASMLLPDGFKERVKER-----GVIWTEWVPQTKILSH 350

  Fly   369 PNTKLFITHAGKGGVAEAQYHGVPMVALPIFGDQQGNAEIMTKSGFGRWLDIL------TMTEHE 427
            .:...|:||.|.|...|....|||::..|...||...|.::  ||....|:|.      ..|...
plant   351 GSVGGFVTHCGWGSAVEGLSFGVPLIMFPCNLDQPLVARLL--SGMNIGLEIPRNERDGLFTSAS 413

  Fly   428 LEQTIREVLGNPAYRETIGKFSTLYRDRPLTARQSV 463
            :.:|||.|:     .|..||   :||:...:.::.:
plant   414 VAETIRHVV-----VEEEGK---IYRNNAASQQKKI 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37E1NP_652628.2 egt 7..475 CDD:223071 105/491 (21%)
YjiC 27..448 CDD:224732 102/474 (22%)
AT5G65550NP_201358.1 Glycosyltransferase_GTB-type 7..461 CDD:385653 105/491 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48043
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.