DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37E1 and AT5G17040

DIOPT Version :9

Sequence 1:NP_652628.2 Gene:Ugt37E1 / 53512 FlyBaseID:FBgn0040261 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_197206.2 Gene:AT5G17040 / 831567 AraportID:AT5G17040 Length:442 Species:Arabidopsis thaliana


Alignment Length:112 Identity:34/112 - (30%)
Similarity:46/112 - (41%) Gaps:26/112 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 SKLPQRVIWKWEDLKNKPGNASNIFFGN--------WLPQDDILAHPNTKLFITHAGKGGVAEAQ 387
            ||:|  .:|..:: ||..........|.        |.||.::|.|....:|::|.|...|.|:.
plant   288 SKVP--FVWSLQE-KNMVHLPKGFLDGTREQGMVVPWAPQVELLNHEAMGVFVSHGGWNSVLESV 349

  Fly   388 YHGVPMVALPIFGDQQGNAE---------------IMTKSGFGRWLD 419
            ..||||:..|||||...||.               :.||.||...||
plant   350 SAGVPMICRPIFGDHALNARSVEAVWEIGMTISSGVFTKDGFEESLD 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37E1NP_652628.2 egt 7..475 CDD:223071 34/112 (30%)
YjiC 27..448 CDD:224732 34/112 (30%)
AT5G17040NP_197206.2 Glycosyltransferase_GTB_type 2..428 CDD:299143 34/112 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.