DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37E1 and AT5G12890

DIOPT Version :9

Sequence 1:NP_652628.2 Gene:Ugt37E1 / 53512 FlyBaseID:FBgn0040261 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_196793.1 Gene:AT5G12890 / 831129 AraportID:AT5G12890 Length:488 Species:Arabidopsis thaliana


Alignment Length:163 Identity:40/163 - (24%)
Similarity:71/163 - (43%) Gaps:36/163 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 ELAKFLDKADEGAIFF---SLGTNVNTNTFRPDTVDILYKVLSKLPQRVIWKWEDLKNKPGNASN 353
            |||..|:.:::..|:.   .:|..|.:.          :.|...||:    .:|:...:  :...
plant   303 ELAMALESSEKNFIWVVRPPIGVEVKSE----------FDVKGYLPE----GFEERITR--SERG 351

  Fly   354 IFFGNWLPQDDILAHPNTKLFITHAGKGGVAEAQYHGVPMVALPIFGDQQGNAEIMTKS------ 412
            :....|.||.|||:|..|.:|::|.|...:.|:..||||::..|:..:|..|:.:|.|.      
plant   352 LLVKKWAPQVDILSHKATCVFLSHCGWNSILESLSHGVPLLGWPMAAEQFFNSILMEKHIGVSVE 416

  Fly   413 -GFGRWLDI----------LTMTEHELEQTIRE 434
             ..|:..:|          |.|.|.|:.:.||:
plant   417 VARGKRCEIKCDDIVSKIKLVMEETEVGKEIRK 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37E1NP_652628.2 egt 7..475 CDD:223071 40/163 (25%)
YjiC 27..448 CDD:224732 40/163 (25%)
AT5G12890NP_196793.1 Glycosyltransferase_GTB-type 2..478 CDD:415824 40/163 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.