DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37E1 and UGT76C1

DIOPT Version :9

Sequence 1:NP_652628.2 Gene:Ugt37E1 / 53512 FlyBaseID:FBgn0040261 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_196206.1 Gene:UGT76C1 / 830472 AraportID:AT5G05870 Length:464 Species:Arabidopsis thaliana


Alignment Length:477 Identity:106/477 - (22%)
Similarity:177/477 - (37%) Gaps:119/477 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 MAVMKALADRGHNITVV-TQMK-PKLATHENITVI-IAPPTEERQRYIKEYMAEV----SNEKPS 100
            :.:.|.|..||.:||:: |:.. ||.:.|...|.: |.....|.|...::.:.::    :|.:..
plant    24 LQLAKILYSRGFSITIIHTRFNAPKSSDHPLFTFLQIRDGLSESQTQSRDLLLQLTLLNNNCQIP 88

  Fly   101 FWETMVKAIVQSSNQLEGQYE-----------FMTHPNVKEIYENPKI-----KFDLVFLG--LM 147
            |.|.:.|.|..||:  .|..:           ::...:|.|.:..|:.     ||.. |||  |:
plant    89 FRECLAKLIKPSSD--SGTEDRKISCVIDDSGWVFTQSVAESFNLPRFVLCAYKFSF-FLGHFLV 150

  Fly   148 ANTYQLGIAAKLKCPVIISWVGIPLP--FMDTIVGNVNDPSYVPTVN------VALNAGQKTMD- 203
            ....:.|.              :|:|  ..|.:|     |.:.|...      :..:|..|.:| 
plant   151 PQIRREGF--------------LPVPDSEADDLV-----PEFPPLRKKDLSRIMGTSAQSKPLDA 196

  Fly   204 FGLRFVNFFKYAIMCVFETVLDYKMNQFYERAFANELEFPNYHEMKRRVSLLFYNYHSASEGPIR 268
            :.|:.::..|.|...:   |:..|           ||:..:..|..:..|:           ||.
plant   197 YLLKILDATKPASGII---VMSCK-----------ELDHDSLAESNKVFSI-----------PIF 236

  Fly   269 PTVPQSIEIGGIQVKEQADPLPKELAKFLD-KADEGAIFFSLGTNVNTNTFRPDTVDILYKVLSK 332
            |..|..|...........:| .:....:|| :.....::.|||:..:.|  ..|.::|... |..
plant   237 PIGPFHIHDVPASSSSLLEP-DQSCIPWLDMRETRSVVYVSLGSIASLN--ESDFLEIACG-LRN 297

  Fly   333 LPQRVIW----------KWEDLKNKPGNASNIFFG-----NWLPQDDILAHPNTKLFITHAGKGG 382
            ..|..:|          .|  :::.|........|     .|.||.|:|||..|..|:||.|...
plant   298 TNQSFLWVVRPGSVHGRDW--IESLPSGFMESLDGKGKIVRWAPQLDVLAHRATGGFLTHNGWNS 360

  Fly   383 VAEAQYHGVPMVALPIFGDQQGNAEIMT---KSGF---GRWLDILTMTEHELEQTIREVLGNPAY 441
            ..|:...||||:.||...||..||..::   :.|.   ||      :...|:|:.:..::.....
plant   361 TLESICEGVPMICLPCKWDQFVNARFISEVWRVGIHLEGR------IERREIERAVIRLMVESKG 419

  Fly   442 RETIGKFSTLYRDRPLTARQSV 463
            .|..|:...| ||.   .|:||
plant   420 EEIRGRIKVL-RDE---VRRSV 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37E1NP_652628.2 egt 7..475 CDD:223071 106/477 (22%)
YjiC 27..448 CDD:224732 100/460 (22%)
UGT76C1NP_196206.1 Glycosyltransferase_GTB_type 2..451 CDD:299143 106/477 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.