DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37E1 and UGT71B5

DIOPT Version :9

Sequence 1:NP_652628.2 Gene:Ugt37E1 / 53512 FlyBaseID:FBgn0040261 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001328018.1 Gene:UGT71B5 / 827194 AraportID:AT4G15280 Length:510 Species:Arabidopsis thaliana


Alignment Length:423 Identity:89/423 - (21%)
Similarity:159/423 - (37%) Gaps:109/423 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 HENITVIIAPPTEE-----RQRYIKEYMAEVSNEKPSFWETMVKAIVQSSNQLEGQYEFMTHPNV 128
            :|:|:|...|||.:     .|.||::       :|....:.:...||..:.:|.|....|...::
plant    99 YESISVAKQPPTSDPDPVPAQVYIEK-------QKTKVRDAVAARIVDPTRKLAGFVVDMFCSSM 156

  Fly   129 KEIYENPKIKFDLV------FLGLMANTYQLGIAAKLKCPVIISWVGIPLPFMDTIVGNVNDPSY 187
            .::.....:...:|      |||.|.:..|:....|           ..:..::..|..:..||.
plant   157 IDVANEFGVPCYMVYTSNATFLGTMLHVQQMYDQKK-----------YDVSELENSVTELEFPSL 210

  Fly   188 VPTVNVA----LNAGQKTMDFGLRFVNFFKYAIMCVFETVLDYKMNQFYERAFANELEFPNYHEM 248
            .....|.    :...::.:...|.....|:             ||........| ||| |  |.:
plant   211 TRPYPVKCLPHILTSKEWLPLSLAQARCFR-------------KMKGILVNTVA-ELE-P--HAL 258

  Fly   249 KRRVSLLFYNYHSASEGPIRPTVPQSIEIGGIQVKEQA---DPLPKELAKFLDKADEGAIFF--- 307
            |      .:|.:.       ..:||...:|.:...|..   |....|:.::||:....::.|   
plant   259 K------MFNING-------DDLPQVYPVGPVLHLENGNDDDEKQSEILRWLDEQPSKSVVFLCF 310

  Fly   308 -SLGTNVNTNTFRPDTVDILYKVLSKLPQRVIW----KWEDLK-NKPGNASNI-------FFG-- 357
             |||......| |...|     .|.:..||.:|    ...::| ::|.:.:|:       |..  
plant   311 GSLGGFTEEQT-RETAV-----ALDRSGQRFLWCLRHASPNIKTDRPRDYTNLEEVLPEGFLERT 369

  Fly   358 -------NWLPQDDILAHPNTKLFITHAGKGGVAEAQYHGVPMVALPIFGDQQGNA-EIMTKSGF 414
                   .|.||..:|..|....|:||.|...:.|:.:.|||||..|::.:|:.|| |::.:.|.
plant   370 LDRGKVIGWAPQVAVLEKPAIGGFVTHCGWNSILESLWFGVPMVTWPLYAEQKVNAFEMVEELGL 434

  Fly   415 G----RWL-------DILTMTEHELEQTIREVL 436
            .    ::|       ::.|:|..::|:.||.|:
plant   435 AVEIRKYLKGDLFAGEMETVTAEDIERAIRRVM 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37E1NP_652628.2 egt 7..475 CDD:223071 89/423 (21%)
YjiC 27..448 CDD:224732 89/423 (21%)
UGT71B5NP_001328018.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2351
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.