DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37E1 and AT3G46700

DIOPT Version :9

Sequence 1:NP_652628.2 Gene:Ugt37E1 / 53512 FlyBaseID:FBgn0040261 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_190254.2 Gene:AT3G46700 / 823823 AraportID:AT3G46700 Length:447 Species:Arabidopsis thaliana


Alignment Length:341 Identity:64/341 - (18%)
Similarity:116/341 - (34%) Gaps:112/341 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 IMCVFETVLDYKMNQFYERAFANELEFPNY------------------------------HEMKR 250
            |.|:.     |....::..|.|.||:.||:                              |:::.
plant   102 IACII-----YDEFMYFCGAVAEELKLPNFIFSTQTATHKVCCNVLSKLNAKKYLIDMEEHDVQN 161

  Fly   251 RV-----SLLFYNYHSASEGPIRP----------------------TVPQSIEIGGIQVKEQADP 288
            :|     .|.:.:..:|:.|.:.|                      |..:|..:..:|.:.|...
plant   162 KVVENMHPLRYKDLPTATFGELEPFLELCRDVVNKRTASAVIINTVTCLESSSLTRLQQELQIPV 226

  Fly   289 LP-------------------KELAKFLDK-ADEGAIFFSLGTNVNTNTFRPDTVDILYKVLSKL 333
            .|                   :...::|:| .....|:.|||:.|...|  .:.:::.:.:|:. 
plant   227 YPLGPLHITDSSTGFTVLQEDRSCVEWLNKQKPRSVIYISLGSMVLMET--KEMLEMAWGMLNS- 288

  Fly   334 PQRVIW--------KWEDLKNKPGNASNI-----FFGNWLPQDDILAHPNTKLFITHAGKGGVAE 385
            .|..:|        ..|.:::.|...|.:     :...|.||.::|.||:...|.:|.|.....|
plant   289 NQPFLWVIRPGSVSGSEGIESLPEEVSKMVLEKGYIVKWAPQIEVLGHPSVGGFWSHCGWNSTLE 353

  Fly   386 AQYHGVPMVALPIFGDQQGNA---EIMTKSGFGRWLDILTMTEHELEQTIREVLGNPAYRETIGK 447
            :...||||:..|..|:|..||   |.:.:.|.        ....|||   |..:.....|..:.|
plant   354 SIVEGVPMICRPYQGEQMLNAIYLESVWRIGI--------QVGGELE---RGAVERAVKRLIVDK 407

  Fly   448 FSTLYRDRPLTARQSV 463
            .....|:|.|..::.:
plant   408 EGASMRERTLVLKEKL 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37E1NP_652628.2 egt 7..475 CDD:223071 64/341 (19%)
YjiC 27..448 CDD:224732 60/324 (19%)
AT3G46700NP_190254.2 Glycosyltransferase_GTB_type 1..446 CDD:299143 64/341 (19%)
YjiC 7..426 CDD:224732 64/341 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.