DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37E1 and UGT74F1

DIOPT Version :9

Sequence 1:NP_652628.2 Gene:Ugt37E1 / 53512 FlyBaseID:FBgn0040261 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_181912.1 Gene:UGT74F1 / 818988 AraportID:AT2G43840 Length:449 Species:Arabidopsis thaliana


Alignment Length:347 Identity:80/347 - (23%)
Similarity:131/347 - (37%) Gaps:96/347 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 GIAA----KLKCPV----IISWV---GIPLPFMDTIVGNVND-PSYV-PTVNVALNAGQKTMDFG 205
            |:||    ...|.|    .:|::   .:.||..|..:..:.| |::| ||       |.....|.
plant   125 GLAAAPFFTQSCAVNYINYLSYINNGSLTLPIKDLPLLELQDLPTFVTPT-------GSHLAYFE 182

  Fly   206 L---RFVNFFKYAIMCVFETVLDYKMNQFYERAFANELEFPNYHEMKRRVSLLFYNYHSASEGPI 267
            :   :|.||.|...:.|         |.|::.....|       |:..:|..:.         .|
plant   183 MVLQQFTNFDKADFVLV---------NSFHDLDLHEE-------ELLSKVCPVL---------TI 222

  Fly   268 RPTVP-----QSI------EIGGIQVKEQADPLPKELAKFLDKADEGA-IFFSLGTNVNTNTFRP 320
            .||||     |.|      ::....:||.|     ....:|||..||: ::.:.|:....::.:.
plant   223 GPTVPSMYLDQQIKSDNDYDLNLFDLKEAA-----LCTDWLDKRPEGSVVYIAFGSMAKLSSEQM 282

  Fly   321 DTVDILYKVLSKLPQRVIWKWEDLKNKPGNASNI-----FFGNWLPQDDILAHPNTKLFITHAGK 380
            :.:.......|.|  .|:...|:.|..||....:     ....|.||..:|::.....|:||.|.
plant   283 EEIASAISNFSYL--WVVRASEESKLPPGFLETVDKDKSLVLKWSPQLQVLSNKAIGCFMTHCGW 345

  Fly   381 GGVAEAQYHGVPMVALPIFGDQQGNAEIM-------------TKSGFGRWLDILTMTEHELEQTI 432
            ....|....||||||:|.:.||..||:.:             .:||..:        ..|:|.:|
plant   346 NSTMEGLSLGVPMVAMPQWTDQPMNAKYIQDVWKVGVRVKAEKESGICK--------REEIEFSI 402

  Fly   433 REVL---GNPAYRETIGKFSTL 451
            :||:   .:...:|..||:..|
plant   403 KEVMEGEKSKEMKENAGKWRDL 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37E1NP_652628.2 egt 7..475 CDD:223071 80/347 (23%)
YjiC 27..448 CDD:224732 78/342 (23%)
UGT74F1NP_181912.1 PLN02173 1..449 CDD:177830 80/347 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.