DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37E1 and AT2G31790

DIOPT Version :9

Sequence 1:NP_652628.2 Gene:Ugt37E1 / 53512 FlyBaseID:FBgn0040261 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_180738.1 Gene:AT2G31790 / 817736 AraportID:AT2G31790 Length:457 Species:Arabidopsis thaliana


Alignment Length:353 Identity:74/353 - (20%)
Similarity:135/353 - (38%) Gaps:93/353 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 LVFLGLMANTYQLGIAAKLKCPVIISWVGIPLPFMDTIVGNVNDPSYVPTVNVALNAGQKTMDFG 205
            ||:..:...||.:.: .:.:.|.:.|:.|.||...|.:      ||:      |...|...:   
plant   139 LVYYHINEGTYDVPV-DRHENPTLASFPGFPLLSQDDL------PSF------ACEKGSYPL--- 187

  Fly   206 LRFVNFFKYAIMCVFETVLDYKMNQFYERAFANELEFP-----NYHEMKRRVSLLFYNYHSASEG 265
                                  :::|..|.|:|.|:..     .:.:::.:| :.:.|    .:.
plant   188 ----------------------LHEFVVRQFSNLLQADCILCNTFDQLEPKV-VKWMN----DQW 225

  Fly   266 PIR---PTVPQSI------EIGGIQVKEQADPLPKELAKFL-DKADEGAIFFSLGTNVNTNTFRP 320
            |::   |.||...      |....:::.......:.:.|:| ::..:..::.:.||.|..:..:.
plant   226 PVKNIGPVVPSKFLDNRLPEDKDYELENSKTEPDESVLKWLGNRPAKSVVYVAFGTLVALSEKQM 290

  Fly   321 DTV---------DILYKV----LSKLPQRVIWKWEDLKNKPGNASNIFFGNWLPQDDILAHPNTK 372
            ..:         ..|:.|    .||||...|   |:.:.|...    ....|:||.::|||.:..
plant   291 KEIAMAISQTGYHFLWSVRESERSKLPSGFI---EEAEEKDSG----LVAKWVPQLEVLAHESIG 348

  Fly   373 LFITHAGKGGVAEAQYHGVPMVALPIFGDQQGNA---EIMTKSGF-----GRWLDILTMTEHELE 429
            .|::|.|.....||...|||||.:|.:.||..||   |.:.|.|.     |..|.    ::.|:.
plant   349 CFVSHCGWNSTLEALCLGVPMVGVPQWTDQPTNAKFIEDVWKIGVRVRTDGEGLS----SKEEIA 409

  Fly   430 QTIREVL---GNPAYRETIGKFSTLYRD 454
            :.|.||:   .....|:.:.|...|.|:
plant   410 RCIVEVMEGERGKEIRKNVEKLKVLARE 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37E1NP_652628.2 egt 7..475 CDD:223071 74/353 (21%)
YjiC 27..448 CDD:224732 71/345 (21%)
AT2G31790NP_180738.1 Glycosyltransferase_GTB_type 3..454 CDD:299143 74/353 (21%)
YjiC 6..454 CDD:224732 74/353 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.