DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37E1 and UGT73B5

DIOPT Version :9

Sequence 1:NP_652628.2 Gene:Ugt37E1 / 53512 FlyBaseID:FBgn0040261 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001189528.1 Gene:UGT73B5 / 816040 AraportID:AT2G15480 Length:494 Species:Arabidopsis thaliana


Alignment Length:280 Identity:68/280 - (24%)
Similarity:102/280 - (36%) Gaps:87/280 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 MNQFY--ERAFANELEFPNYHEMKRRVSLLFYNYHSASEG-PIRPTVPQSIEIG-------GIQV 282
            :|.||  |.|:|:                 ||....|... .|.|....:.|:|       ...:
plant   226 VNSFYELESAYAD-----------------FYRSFVAKRAWHIGPLSLSNRELGEKARRGKKANI 273

  Fly   283 KEQADPLPKELAKFLDKADEGA-IFFSLGTNVN-TNTFRPDTVDILYKV---LSKLPQRVIW--- 339
            .||      |..|:||....|: ::.|.|:..| ||       |.|.::   |....|..||   
plant   274 DEQ------ECLKWLDSKTPGSVVYLSFGSGTNFTN-------DQLLEIAFGLEGSGQSFIWVVR 325

  Fly   340 ---------KW--EDLKNKPGNASNIFFGNWLPQDDILAHPNTKLFITHAGKGGVAEAQYHGVPM 393
                     :|  |..|.:. ....:....|.||..||.|.....|:||.|.....|....|:||
plant   326 KNENQGDNEEWLPEGFKERT-TGKGLIIPGWAPQVLILDHKAIGGFVTHCGWNSAIEGIAAGLPM 389

  Fly   394 VALPIFGDQQGNAEIMTKSGFGRWLDIL----------------TMTEHELEQTIREVL-GNPAY 441
            |..|:..:|..|.:::||        :|                .::..::|:.:|||: |..|.
plant   390 VTWPMGAEQFYNEKLLTK--------VLRIGVNVGATELVKKGKLISRAQVEKAVREVIGGEKAV 446

  Fly   442 RETIGKFSTLYRDRPLTARQ 461
            ||.||  .....:|.|.|::
plant   447 REVIG--GEKAEERRLRAKE 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37E1NP_652628.2 egt 7..475 CDD:223071 68/280 (24%)
YjiC 27..448 CDD:224732 65/265 (25%)
UGT73B5NP_001189528.1 PLN03007 4..494 CDD:178584 68/280 (24%)
MGT 14..456 CDD:273616 65/270 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.