DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37E1 and UGT2A3

DIOPT Version :9

Sequence 1:NP_652628.2 Gene:Ugt37E1 / 53512 FlyBaseID:FBgn0040261 Length:539 Species:Drosophila melanogaster
Sequence 2:XP_011530549.1 Gene:UGT2A3 / 79799 HGNCID:28528 Length:533 Species:Homo sapiens


Alignment Length:528 Identity:143/528 - (27%)
Similarity:235/528 - (44%) Gaps:94/528 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SHVIVHMAVMKALADRGHNITVVTQMKPKLATHE-----NITVIIAPP--TEERQRYIKEYMAEV 94
            ||.:....:::.|..|||.:||:|..||.|..:.     ...|:..|.  |||.:.::...:   
Human    34 SHWLNVKVILEELIVRGHEVTVLTHSKPSLIDYRKPSALKFEVVHMPQDRTEENEIFVDLAL--- 95

  Fly    95 SNEKP--SFWETMVKA---IVQSSNQLEGQYEFMTHPN--VKEIYENPKIKFDLVFLGLMANTYQ 152
             |..|  |.|::::|.   .|:....|:...|...:..  :|::.|.   .:|::.:..:.....
Human    96 -NVLPGLSTWQSVIKLNDFFVEIRGTLKMMCESFIYNQTLMKKLQET---NYDVMLIDPVIPCGD 156

  Fly   153 LGIAAKLKCPVIISW---VGIPLPFMDTIVGNVNDP-SYVPTVNVALNAGQKTMDFGLRFVNFFK 213
            | :|..|..|.:::.   ||   ..|:...|.:..| ||||   |.:......|.|..|..|...
Human   157 L-MAELLAVPFVLTLRISVG---GNMERSCGKLPAPLSYVP---VPMTGLTDRMTFLERVKNSML 214

  Fly   214 YAIMCVFETVLDYKM-NQFYERAFAN--------------------ELEFPNYHEMKRRVSLLFY 257
            ..:...:....||.. .:||.:|...                    :.|||              
Human   215 SVLFHFWIQDYDYHFWEEFYSKALGRPTTLCETVGKAEIWLIRTYWDFEFP-------------- 265

  Fly   258 NYHSASEGPIRPTVPQSIEIGGIQVKEQADPLPK------ELAKFLDKA-DEGAIFFSLGTNVNT 315
                      :|..|....:||:..| .|..|||      |:..|:..: ::|.:.||||:....
Human   266 ----------QPYQPNFEFVGGLHCK-PAKALPKINFYLQEMENFVQSSGEDGIVVFSLGSLFQN 319

  Fly   316 NTFRPDTVDILYKVLSKLPQRVIWKWEDLKNKPGN-ASNIFFGNWLPQDDILAHPNTKLFITHAG 379
            .|  .:..:|:...|:::||:|:|:::.  .||.. .:|....:|:||:|:|.||.||.||||.|
Human   320 VT--EEKANIIASALAQIPQKVLWRYKG--KKPSTLGANTRLYDWIPQNDLLGHPKTKAFITHGG 380

  Fly   380 KGGVAEAQYHGVPMVALPIFGDQQGNAEIMTKSGFGRWLDILTMTEHELEQTIREVLGNPAYRET 444
            ..|:.||.|||||||.:||||||..|...|...|....::..|||..:|.:.:|.|:.:.:|:|.
Human   381 MNGIYEAIYHGVPMVGVPIFGDQLDNIAHMKAKGAAVEINFKTMTSEDLLRALRTVITDSSYKEN 445

  Fly   445 IGKFSTLYRDRPLTARQSVIYWTEYVLRHQGALHLQSPLIHTKFVARNNLDVYGVVLLVSLLLIV 509
            ..:.|.::.|:|:......::|.|:|:||:||.||:|......:....::||.|.:    |..:.
Human   446 AMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRSAAHDLTWFQHYSIDVIGFL----LACVA 506

  Fly   510 TIKFLFRK 517
            |..|||.|
Human   507 TAIFLFTK 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37E1NP_652628.2 egt 7..475 CDD:223071 129/484 (27%)
YjiC 27..448 CDD:224732 121/457 (26%)
UGT2A3XP_011530549.1 UDPGT 24..528 CDD:278624 143/528 (27%)
egt <267..498 CDD:223071 81/235 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150242
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BDT1
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.