DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37E1 and Ugt2b10

DIOPT Version :9

Sequence 1:NP_652628.2 Gene:Ugt37E1 / 53512 FlyBaseID:FBgn0040261 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001178605.1 Gene:Ugt2b10 / 305264 RGDID:1309989 Length:532 Species:Rattus norvegicus


Alignment Length:555 Identity:156/555 - (28%)
Similarity:254/555 - (45%) Gaps:99/555 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LIAFLLSTMTQSSGGANILGVFGTHSPSHVIVHMAVMKALADRGHNITVVTQMKPKLATH---EN 71
            |:...||....|..|..:| |:.... ||.:....::..|..:||.:||   ::|..:..   :|
  Rat    11 LLLLQLSDFFGSGTGGKVL-VWPMEF-SHWLNLRVILDELLKKGHEVTV---LRPSASLSYEVDN 70

  Fly    72 ITVIIAPPTEERQRYIKEY-MAEVSNEKPSFWETMVKAIVQSSNQLEGQYEFMTHPNV------- 128
            .:.|      |.:.|...| :.||..   .|||::.|.|.:...|....|..|....|       
  Rat    71 TSAI------EFETYPTSYSLTEVDE---FFWESLRKYIYELPKQSFWGYFLMFQELVWVDSDYF 126

  Fly   129 ----KEIYENPKIK-------FDLVFLGLMANTYQLGIAAKLKCPVIISW------------VGI 170
                |::..|.::.       ||::..........| :|..||.|::.|.            .|:
  Rat   127 ESLCKDVVFNKELMTKLQNSGFDVILADPFIPCGDL-LAEILKIPLVYSLRFFPGSTYEKYSGGL 190

  Fly   171 PLPFMDTIVGNVNDPSYVPTVNVALNAGQKTMDFGLRFVNFFKYAI--MCVFETVLDYKMNQFYE 233
            |:|           |||||   :|::    .:...:.||...|:.|  :|     .|:....|.|
  Rat   191 PMP-----------PSYVP---IAMS----ELSDRMTFVERMKHMIYVLC-----FDFWFQAFNE 232

  Fly   234 RAFANELEFPNYHEMKRRVSLLFYNYHSASEGPIR---------PTVPQSIEIGGIQVKEQADPL 289
            :.: |||    |.|:..|.:.|......|....||         |.:|....:||:..: .|.||
  Rat   233 KKW-NEL----YTEVLGRPTTLSETMAKADIWLIRTYWDLEFPHPVLPNFDFVGGLHCR-PAKPL 291

  Fly   290 PKELAKFLDKADE-GAIFFSLGTNVNTNTFRPDTVDILYKVLSKLPQRVIWKWEDLKNKPGN-AS 352
            |||:..|:..:.| |.:.||||:.|...|  .:..:::...|:::||:|:|::|.  .||.. .|
  Rat   292 PKEIEDFVQSSGEHGVVVFSLGSMVGNLT--EERANVIAAGLAQIPQKVLWRFEG--KKPETLGS 352

  Fly   353 NIFFGNWLPQDDILAHPNTKLFITHAGKGGVAEAQYHGVPMVALPIFGDQQGNAEIMTKSGFGRW 417
            |.....|:||:|:|.||.|:.||||.|..|:.||.|||:|:|.:|:||||..|...:...|....
  Rat   353 NTRLYKWIPQNDLLGHPKTRAFITHGGTNGIYEAIYHGIPVVGIPLFGDQYDNIVHLKTKGAAVR 417

  Fly   418 LDILTMTEHELEQTIREVLGNPAYRETIGKFSTLYRDRPLTARQSVIYWTEYVLRHQGALHLQSP 482
            ||.|||:..:|...::.:..:|:|:|...:.|.::.|:|:......::|.|:|:||:||.||:..
  Rat   418 LDFLTMSSTDLFTALKTITNDPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVA 482

  Fly   483 LIHTKFVARNNLDVYGVVLLVSLLLIVTIKFLFRK 517
            .....:|..::|||.|.:    |..:||:.|:.:|
  Rat   483 AHDLSWVQYHSLDVIGFL----LACVVTVMFILKK 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37E1NP_652628.2 egt 7..475 CDD:223071 142/511 (28%)
YjiC 27..448 CDD:224732 129/467 (28%)
Ugt2b10NP_001178605.1 UDPGT 26..529 CDD:278624 151/540 (28%)
egt 35..510 CDD:223071 147/525 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344128
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BDT1
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.