DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37E1 and Ugt3a2

DIOPT Version :9

Sequence 1:NP_652628.2 Gene:Ugt37E1 / 53512 FlyBaseID:FBgn0040261 Length:539 Species:Drosophila melanogaster
Sequence 2:XP_038959826.1 Gene:Ugt3a2 / 294793 RGDID:1564365 Length:454 Species:Rattus norvegicus


Alignment Length:420 Identity:121/420 - (28%)
Similarity:191/420 - (45%) Gaps:34/420 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 MTHPNVKEIYENPKIKFDLVFLGLMANTYQLGIAAKLKCPVIISWVGIPLPFMDTIVGNVNDP-S 186
            ::..::.|..:|  ..||||....:.....| |..||....:: ::...|.|||..:..|  | |
  Rat    55 LSRKDIMEFLKN--ANFDLVLFESVDYCSSL-IVEKLGKQFVL-FLAFQLGFMDFELQRV--PLS 113

  Fly   187 YVPTVNVALNAGQKTMDFGLRFVNFFKYAIMCVFETVLDYKMNQFYERAFANELEFPNYHEMKRR 251
            |||.....|.   ..|||..|..||..:..:...:..:..:.:...:..|| |...|...::..:
  Rat   114 YVPVYGSGLT---DQMDFWGRVKNFLMFFDLSRKQREILSQYDSTIQEHFA-EGSRPVLSDLLLK 174

  Fly   252 VSLLFYNYHSASEGPIRPTVPQSIEIGGIQVKEQADPLPKELAKFLDK-ADEGAIFFSLGTNVNT 315
            ..|.|.|...|.|. .||..|..:.:||: :.:....:|::|..|:.: .|.|.:..:||| |.|
  Rat   175 AELWFVNCDFAFEF-ARPLFPNIVYVGGL-LDKPVQSIPQDLENFITQFGDSGFVLVALGT-VAT 236

  Fly   316 NTFRPDTVDILYKVLSKLPQRVIWKWEDLKNKPGN---ASNIFFGNWLPQDDILAHPNTKLFITH 377
            .....:.:..:....:.|||.|||..:| .:.|.:   |.|:...:||||.|:||||:.:||:||
  Rat   237 KFQTKEIIKEMNNAFAHLPQGVIWACKD-SHWPKDVTLAPNVKIMDWLPQTDLLAHPSIRLFVTH 300

  Fly   378 AGKGGVAEAQYHGVPMVALPIFGDQQGNAEIMTKSGFGRWLDILTMTEHELEQTIREVLGNPAYR 442
            .|...|.||..||||||.:..|.||..|...:.....|..:.|.|:......:|::||:.:..|:
  Rat   301 GGMNSVNEAIQHGVPMVGILFFSDQPENMIRVEAKTIGVSIQIQTLKAETFARTMKEVIEDKRYK 365

  Fly   443 ETIGKFSTLYRDRPLTARQSVIYWTEYVLRHQGALHL-----QSPLIHTKFVARNNLDVYGVVLL 502
            ........:....|||..|.:..|.:::|:..||.||     |.|. |.:::    |||:    |
  Rat   366 SAAMASKIIRHSHPLTPSQRLEGWIDHILQTGGAAHLKPYAFQQPW-HEQYL----LDVF----L 421

  Fly   503 VSLLLIVTIKFLFRKILNVAIGY-GSQRKA 531
            ..|.|.:...:|..|:|...:.| ...|||
  Rat   422 FLLGLTLGTVWLCVKVLGAVMRYLSGARKA 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37E1NP_652628.2 egt 7..475 CDD:223071 101/356 (28%)
YjiC 27..448 CDD:224732 95/329 (29%)
Ugt3a2XP_038959826.1 Glycosyltransferase_GTB-type 49..419 CDD:415824 109/382 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344173
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.