DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37E1 and Y43D4A.2

DIOPT Version :9

Sequence 1:NP_652628.2 Gene:Ugt37E1 / 53512 FlyBaseID:FBgn0040261 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_502984.3 Gene:Y43D4A.2 / 189851 WormBaseID:WBGene00012788 Length:151 Species:Caenorhabditis elegans


Alignment Length:107 Identity:26/107 - (24%)
Similarity:40/107 - (37%) Gaps:22/107 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 KEIYENPKIK-FDLVF---LGLMANTYQLGIAAKLKCPVIISWVGIPLPFMDTIVGNVNDPSYVP 189
            ||:.|..:.: |||..   ....||.  |..|.|::..|.:.... .|..:...:|....|||:|
 Worm    30 KELIERLRAENFDLAITEPFDTCANA--LFEAIKIRAHVAVLSCS-RLDHVSKAIGQPIAPSYLP 91

  Fly   190 TVNVALNAGQKTMDFGLRFVNFFKYAIMCVFETVLDYKMNQF 231
              ......|:: |....||:|            :|.:.|..|
 Worm    92 --GTQSTHGER-MTIWQRFMN------------ILHFLMGDF 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37E1NP_652628.2 egt 7..475 CDD:223071 26/107 (24%)
YjiC 27..448 CDD:224732 26/107 (24%)
Y43D4A.2NP_502984.3 UDPGT 14..>120 CDD:278624 26/107 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.