DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37D1 and AT4G36770

DIOPT Version :9

Sequence 1:NP_001285989.1 Gene:Ugt37D1 / 53511 FlyBaseID:FBgn0040260 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_195395.4 Gene:AT4G36770 / 829830 AraportID:AT4G36770 Length:457 Species:Arabidopsis thaliana


Alignment Length:224 Identity:56/224 - (25%)
Similarity:90/224 - (40%) Gaps:57/224 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 GP-IRPNVPGVIEIGGIQVKSKPDPLPEDIQEFLE-KGKHGAILFSLGSNLKGEHIQPEVVKTIF 332
            || :||..||               |...:.::|: :.|...:..|.||   |..:..|....:.
plant   239 GPLVRPAEPG---------------LKHGVLDWLDLQPKESVVYVSFGS---GGALTFEQTNELA 285

  Fly   333 KGLSSLKQQVIW-----KWEDP--------KN-------TPG------KSANILYKKWLPQDDIL 371
            .||.....:.:|     ..:||        ||       .|.      |...::.:.|.||::||
plant   286 YGLELTGHRFVWVVRPPAEDDPSASMFDKTKNETEPLDFLPNGFLDRTKDIGLVVRTWAPQEEIL 350

  Fly   372 AHPKLKLFITHAGKGGVAEAQYHGVPMLALPVFADQPGNADKLVASGYGLQLPLATLDVDEFKAA 436
            ||.....|:||.|...|.|:..:||||:|.|::::|..|| ::|:....:.|.:...|....|..
plant   351 AHKSTGGFVTHCGWNSVLESIVNGVPMVAWPLYSEQKMNA-RMVSGELKIALQINVADGIVKKEV 414

  Fly   437 IKEVI----------ENPKYAKTLKSFSQ 455
            |.|::          |..|..|.||..::
plant   415 IAEMVKRVMDEEEGKEMRKNVKELKKTAE 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37D1NP_001285989.1 egt 25..512 CDD:223071 56/224 (25%)
UDPGT 45..530 CDD:278624 56/224 (25%)
AT4G36770NP_195395.4 Glycosyltransferase_GTB_type 4..448 CDD:299143 56/224 (25%)
YjiC 6..451 CDD:224732 56/224 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.