DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37D1 and UGT84A2

DIOPT Version :9

Sequence 1:NP_001285989.1 Gene:Ugt37D1 / 53511 FlyBaseID:FBgn0040260 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_188793.1 Gene:UGT84A2 / 821710 AraportID:AT3G21560 Length:496 Species:Arabidopsis thaliana


Alignment Length:235 Identity:42/235 - (17%)
Similarity:92/235 - (39%) Gaps:63/235 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 NVPGVI---------------EIGGIQVKSKPDPLPEDIQEFLEKGKHGAILF-SLGSNLKGEHI 323
            ::||||               ::..:.:....||    ..|:|:.....:::: |.|:   ..::
plant   242 SLPGVIRPLGPLYKMAKTVAYDVVKVNISEPTDP----CMEWLDSQPVSSVVYISFGT---VAYL 299

  Fly   324 QPEVVKTIFKGLSSLKQQVIW------------KWEDPKNTPGKSANILYKKWLPQDDILAHPKL 376
            :.|.:..|..|:.:.....:|            |...|:...||...:   :|..|:.:|:||.:
plant   300 KQEQIDEIAYGVLNADVTFLWVIRQQELGFNKEKHVLPEEVKGKGKIV---EWCSQEKVLSHPSV 361

  Fly   377 KLFITHAGKGGVAEAQYHGVPMLALPVFADQPGNADKLVASGYGLQLPLATLDVDEFKAAIK--- 438
            ..|:||.|.....||...|||.:..|.:.||..:|..:               :|.:|..::   
plant   362 ACFVTHCGWNSTMEAVSSGVPTVCFPQWGDQVTDAVYM---------------IDVWKTGVRLSR 411

  Fly   439 -----EVIENPKYAKTLKSFSQLYRDRPLSPQESVVYWTE 473
                 .::...:.|:.|:..::  .::.:..:::.:.|.|
plant   412 GEAEERLVPREEVAERLREVTK--GEKAIELKKNALKWKE 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37D1NP_001285989.1 egt 25..512 CDD:223071 42/235 (18%)
UDPGT 45..530 CDD:278624 42/235 (18%)
UGT84A2NP_188793.1 Glycosyltransferase_GTB-type 1..485 CDD:415824 42/235 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.