DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37D1 and UGT2B15

DIOPT Version :9

Sequence 1:NP_001285989.1 Gene:Ugt37D1 / 53511 FlyBaseID:FBgn0040260 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_001067.2 Gene:UGT2B15 / 7366 HGNCID:12546 Length:530 Species:Homo sapiens


Alignment Length:536 Identity:165/536 - (30%)
Similarity:267/536 - (49%) Gaps:78/536 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SHFIVHMSIMKTLAEKGHNVTVVSSVPPKVTHKS----INHIVVPMS-----AEDE--KVLNDGM 98
            ||:|...:|::.|.::||.|||::|....:.:.|    |...|.|.|     .||.  |:|:..:
Human    34 SHWINMKTILEELVQRGHEVTVLTSSASTLVNASKSSAIKLEVYPTSLTKNYLEDSLLKILDRWI 98

  Fly    99 AGMVKEKPSIWNTMKSIFSSLALLIDKQVDVLEDPRFQELYLNK-------GNKFDVVFVGFFFN 156
            .|:.|      ||..|.||.|..|..:..| ..:...::..|||       .:||||:... ..|
Human    99 YGVSK------NTFWSYFSQLQELCWEYYD-YSNKLCKDAVLNKKLMMKLQESKFDVILAD-ALN 155

  Fly   157 TYQVALGARFNCPVIIS---------------WSGPPMMMVNEVLGNPELSSVPQMHISAPPGQP 206
            .....|...||.|.:.|               :..||             |.||.  :.:.....
Human   156 PCGELLAELFNIPFLYSLRFSVGYTFEKNGGGFLFPP-------------SYVPV--VMSELSDQ 205

  Fly   207 MNFQQRMQNFASTLGFNA-LNIFLNHKYNKFYDRLWSKDKSM-PTFAQAKRNVSLAFCNGHGISE 269
            |.|.:|::|....|.|:. ..|:...|:::||..:..:..:: .|..:|:..:...:.:    .|
Human   206 MIFMERIKNMIHMLYFDFWFQIYDLKKWDQFYSEVLGRPTTLFETMGKAEMWLIRTYWD----FE 266

  Fly   270 GPIRPNVPGVIEIGGIQVKSKPDPLPEDIQEFLE-KGKHGAILFSLGSNLKGEHIQPEVVKTIFK 333
            .| ||.:|.|..:||:..| ...|||::::||:: .|::|.::|||||.:  .::..|....|..
Human   267 FP-RPFLPNVDFVGGLHCK-PAKPLPKEMEEFVQSSGENGIVVFSLGSMI--SNMSEESANMIAS 327

  Fly   334 GLSSLKQQVIWKWEDPK-NTPGKSANILYKKWLPQDDILAHPKLKLFITHAGKGGVAEAQYHGVP 397
            .|:.:.|:|:|:::..| ||.|.:.. || |||||:|:|.|||.|.||||.|..|:.||.|||:|
Human   328 ALAQIPQKVLWRFDGKKPNTLGSNTR-LY-KWLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIP 390

  Fly   398 MLALPVFADQPGNADKLVASGYGLQLPLATLDVDEFKAAIKEVIENPKYAKTLKSFSQLYRDRPL 462
            |:.:|:||||..|...:.|.|..|.:.:.|:...:...|:|.||.:|.|.:.:...|:::.|:|:
Human   391 MVGIPLFADQHDNIAHMKAKGAALSVDIRTMSSRDLLNALKSVINDPVYKENVMKLSRIHHDQPM 455

  Fly   463 SPQESVVYWTEYVIRHHGAAHMQSPLVHMNFIASNNLD-IYIIAALVLYIVFIINKIVWKFVWRK 526
            .|.:..|:|.|:|:||.||.|::....::.:|..::|| |..:.|.|..::|||.|.. .|.:||
Human   456 KPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQYHSLDVIAFLLACVATVIFIITKFC-LFCFRK 519

  Fly   527 LFGKSNKVSKGKKVKK 542
            |      ..||||.|:
Human   520 L------AKKGKKKKR 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37D1NP_001285989.1 egt 25..512 CDD:223071 152/504 (30%)
UDPGT 45..530 CDD:278624 160/522 (31%)
UGT2B15NP_001067.2 egt 8..508 CDD:223071 152/506 (30%)
UDPGT 24..518 CDD:278624 157/517 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150298
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.