DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37D1 and T19H12.12

DIOPT Version :9

Sequence 1:NP_001285989.1 Gene:Ugt37D1 / 53511 FlyBaseID:FBgn0040260 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_001024147.2 Gene:T19H12.12 / 3565072 WormBaseID:WBGene00044282 Length:153 Species:Caenorhabditis elegans


Alignment Length:149 Identity:29/149 - (19%)
Similarity:54/149 - (36%) Gaps:54/149 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SHFIVHMSIMKTLAEKGHNVTVVSSVPPKVTHKSINHIVVPMSAEDEKVLNDGMAGMVKEKPSIW 109
            ||......:...:|:.||:||:..  |..:..|:::                   |:||      
 Worm    31 SHVKFISKVADIIADHGHHVTLFQ--PYHIALKNLD-------------------GLVK------ 68

  Fly   110 NTMKSIFSSLALLIDKQVDVL--EDPRFQELYLNKGNKFDVVFVGFFFNTYQV---ALGARFNCP 169
                          :|.:::|  ....::||...:...|     .||::::.|   .:|| |..|
 Worm    69 --------------NKNIEILNYHPTHYEELLKAEPQAF-----SFFWDSHLVGNPVIGA-FLMP 113

  Fly   170 VIISWSGPPMMMVNEVLGN 188
            .:|  .|...:...|||.:
 Worm   114 KLI--GGEFKITAMEVLSD 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37D1NP_001285989.1 egt 25..512 CDD:223071 29/149 (19%)
UDPGT 45..530 CDD:278624 29/149 (19%)
T19H12.12NP_001024147.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.