DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37D1 and UGT2B11

DIOPT Version :9

Sequence 1:NP_001285989.1 Gene:Ugt37D1 / 53511 FlyBaseID:FBgn0040260 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_001064.1 Gene:UGT2B11 / 10720 HGNCID:12545 Length:529 Species:Homo sapiens


Alignment Length:534 Identity:144/534 - (26%)
Similarity:248/534 - (46%) Gaps:75/534 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SHFIVHMSIMKTLAEKGHNVTVVSS------------------VPPKVTHKSINHIVVPMSAEDE 91
            ||::...:|:|.|.::||.|||::|                  .|..:|.....:|::.......
Human    34 SHWMNMKTILKELVQRGHEVTVLASSASILFDPNDASTLKFEVYPTSLTKTEFENIIMQQVKRWS 98

  Fly    92 KVLNDGM-AGMVKEKPSIWNTMKSIFSSLALLIDKQVDVLEDPRFQELYLNKGNKFDVVFVGFFF 155
            .:..|.. ....:|:..:|. :..||.:....:.....|::  :.||      ::||:||....|
Human    99 DIRKDSFWLYFSQEQEILWE-LYDIFRNFCKDVVSNKKVMK--KLQE------SRFDIVFADAVF 154

  Fly   156 NTYQVALGARFNCPVIISWSGPPMMMVNEVLGN----PELSSVPQMHISAPPGQPMNFQQRMQNF 216
            ...:: |.|..|...:.|....|...:....|.    |....:....:|    ..|.|.:|::|.
Human   155 PCGEL-LAALLNIRFVYSLRFTPGYTIERHSGGLIFPPSYIPIVMSKLS----DQMTFMERVKNM 214

  Fly   217 ASTLGFNA-LNIFLNHKYNKFYDRLWSKDKSM-PTFAQA----KRNVSLAFCNGHGISEGPIRPN 275
            ...|.|:. ..:....|:::||..:..:..:: .|..:|    .|| |.:|...|        |.
Human   215 IYVLYFDFWFQMSDMKKWDQFYSEVLGRPTTLFETMGKADIWLMRN-SWSFQFPH--------PF 270

  Fly   276 VPGVIEIGGIQVKSKPDPLPEDIQEFLE-KGKHGAILFSLGSNLKGEHIQPEVVKTIFKGLSSLK 339
            :|.|..:||...| ...|||::::||:: .|::|.::|||||.:  .::..|....|...|:.:.
Human   271 LPNVDFVGGFHCK-PAKPLPKEMEEFVQSSGENGVVVFSLGSVI--SNMTAERANVIATALAKIP 332

  Fly   340 QQVIWKWEDPKNTP-GKSANILYKKWLPQDDILAHPKLKLFITHAGKGGVAEAQYHGVPMLALPV 403
            |:|:|:::.  |.| ....|....||:||:|:|.|||.:.||||.|..|:.||.|||:||:.:|:
Human   333 QKVLWRFDG--NKPDALGLNTRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPL 395

  Fly   404 FADQPGNADKLVASGYGLQLPLATLDVDEFKAAIKEVIENPKYAKTLKSFSQLYRDRPLSPQESV 468
            |.|||.|...:.|.|..::|...|:...:...|:|.||.:|.|.:.:...|::..|:|:.|.:..
Human   396 FFDQPDNIAHMKAKGAAVRLDFNTMSSTDLLNALKTVINDPLYKENIMKLSRIQHDQPVKPLDRA 460

  Fly   469 VYWTEYVIRHHGAAHMQSPLVHMNFIASNNLDIY-IIAALVLYIVFIINKI----VWKFVWRKLF 528
            |:|.|:|:.|.||.|::.....:.:...::||:. .:.|.|..::|||.|.    .|||      
Human   461 VFWIEFVMPHKGAKHLRVAAHDLTWFQYHSLDVIGFLLACVATVIFIITKFCLFCFWKF------ 519

  Fly   529 GKSNKVSKGKKVKK 542
                 ..||||.|:
Human   520 -----ARKGKKGKR 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37D1NP_001285989.1 egt 25..512 CDD:223071 132/498 (27%)
UDPGT 45..530 CDD:278624 139/520 (27%)
UGT2B11NP_001064.1 UDPGT 24..525 CDD:278624 141/529 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150539
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.