DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302C1 and UGT72B3

DIOPT Version :9

Sequence 1:NP_652626.1 Gene:Ugt302C1 / 53510 FlyBaseID:FBgn0040259 Length:528 Species:Drosophila melanogaster
Sequence 2:NP_001322549.1 Gene:UGT72B3 / 837503 AraportID:AT1G01420 Length:484 Species:Arabidopsis thaliana


Alignment Length:398 Identity:89/398 - (22%)
Similarity:149/398 - (37%) Gaps:98/398 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GHQVTIISPFELKKPIKNIKDVPAKSILTSMQGRIANLL----QSSKEPIIKQIINFHEMGIEIT 113
            |..||.|.|.: ..|.|     ..:|:|.|:...||::.    ..|..|...:|    |..|.:|
plant    38 GFTVTFIIPGD-SPPSK-----AQRSVLNSLPSSIASVFLPPADLSDVPSTARI----ETRISLT 92

  Fly   114 ELLLKEPSVIEL---MKSNQTFDAV-ISEVFLNEAHFGFAEHFKAPLIGLGTFGAISWN--TDLV 172
             :....|::.||   :.:.:...|| :.::|..:|....||...:|.|    |.|.:.|  |.|:
plant    93 -VTRSNPALRELFGSLSAEKRLPAVLVVDLFGTDAFDVAAEFHVSPYI----FYASNANVLTFLL 152

  Fly   173 GSP-------------SPPSYVPSAL-LKFSDRMSLVERVGNQAFLTYEYIFLNYFYLPRQEVLY 223
            ..|             :.|..:|..: :...|   .|:...::...:|:::..|.......|.:.
plant   153 HLPKLDETVSCEFRELTEPVIIPGCVPITGKD---FVDPCQDRKDESYKWLLHNVKRFKEAEGIL 214

  Fly   224 RKYFPNNKQDFYDMRKNTALVLLNQHVSLSFPRPYSPNMIEVG-----GMH---INRKRQPLPKD 280
                   ...|.|:..||..::..       |.|..|.:..:|     |.|   :|.:.:     
plant   215 -------VNSFVDLEPNTIKIVQE-------PAPDKPPVYLIGPLVNSGSHDADVNDEYK----- 260

  Fly   281 ILEFIEGAEHG-VIYFSMGSNLKSKTLPLEKRQALIDTFAQLKQRVLWKFEDTD----------- 333
            .|.:::....| |:|.|.||   ..||..|:...|....|:..:|.||......           
plant   261 CLNWLDNQPFGSVLYVSFGS---GGTLTFEQFIELALGLAESGKRFLWVIRSPSGIASSSYFNPQ 322

  Fly   334 --------LP------GKPANVFISDWFPQDDILAHDNVLAFITHGGLLSTTESIYHRKPFVGIP 384
                    ||      .|...:.:..|.||..||.|.::..|:||.|..|:.|||.:..|.:..|
plant   323 SRNDPFSFLPQGFLDRTKEKGLVVGSWAPQAQILTHTSIGGFLTHCGWNSSLESIVNGVPLIAWP 387

  Fly   385 IFGDQFLN 392
            ::.:|.:|
plant   388 LYAEQKMN 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302C1NP_652626.1 egt <117..466 CDD:223071 71/330 (22%)
UGT72B3NP_001322549.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.