DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302C1 and UGT75B1

DIOPT Version :9

Sequence 1:NP_652626.1 Gene:Ugt302C1 / 53510 FlyBaseID:FBgn0040259 Length:528 Species:Drosophila melanogaster
Sequence 2:NP_001320882.1 Gene:UGT75B1 / 837058 AraportID:AT1G05560 Length:519 Species:Arabidopsis thaliana


Alignment Length:281 Identity:68/281 - (24%)
Similarity:101/281 - (35%) Gaps:86/281 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 VPSALLKFSDRMSLVERVGNQAFLTYEYIFL---NYFYLPRQEVLYRKYFP------NNKQDFYD 236
            :|||||.....:         .|..|...|:   :.|.||....|..:..|      |..:..||
plant   178 LPSALLWIQPAL---------VFNIYYTHFMGNKSVFELPNLSSLEIRDLPSFLTPSNTNKGAYD 233

  Fly   237 ---------MRKNTALVLLNQHVSL------SFPRPYSPNMIEVGGMHINRKRQPLPKDI----- 281
                     :::....:|:|...||      :||   :.:|:.||.:        ||.:|     
plant   234 AFQEMMEFLIKETKPKILINTFDSLEPEALTAFP---NIDMVAVGPL--------LPTEIFSGST 287

  Fly   282 ------------LEFIEGAEHGVIYFSMGSNLK-SKTLPLEKRQALIDTFAQLKQRVLWKFED-- 331
                        |......|..|||.|.|:.:: ||....|..:|||:.    |:..||...|  
plant   288 NKSVKDQSSSYTLWLDSKTESSVIYVSFGTMVELSKKQIEELARALIEG----KRPFLWVITDKS 348

  Fly   332 ---TDLPGKPANV---------------FISDWFPQDDILAHDNVLAFITHGGLLSTTESIYHRK 378
               |...|:....               .|..|..|.::|:|..|..|:||.|..||.||:....
plant   349 NRETKTEGEEETEIEKIAGFRHELEEVGMIVSWCSQIEVLSHRAVGCFVTHCGWSSTLESLVLGV 413

  Fly   379 PFVGIPIFGDQFLNMARAEQN 399
            |.|..|::.||..|....|::
plant   414 PVVAFPMWSDQPTNAKLLEES 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302C1NP_652626.1 egt <117..466 CDD:223071 68/281 (24%)
UGT75B1NP_001320882.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.