DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302C1 and AT5G37950

DIOPT Version :9

Sequence 1:NP_652626.1 Gene:Ugt302C1 / 53510 FlyBaseID:FBgn0040259 Length:528 Species:Drosophila melanogaster
Sequence 2:NP_198611.1 Gene:AT5G37950 / 833774 AraportID:AT5G37950 Length:351 Species:Arabidopsis thaliana


Alignment Length:393 Identity:90/393 - (22%)
Similarity:140/393 - (35%) Gaps:105/393 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LAKGLAAAGHQVTII-SPFELKKPIKNIKD---------VPAKSILTSMQGRIANLLQSSKEPII 99
            |.:..:..|..:|:. :.|....|.|::.|         :||..:.|  .|.|..:::.:||   
plant     4 LGRAHSLKGFSITVAQTKFNYLNPSKDLADFQFITIPESLPASDLKT--LGPIWFIIKLNKE--- 63

  Fly   100 KQIINFHEMGIEITELLLKEPSVIELMKSNQTFDAVISEVFLNEAHFGFAEHFKAPLIGLGTFGA 164
                         .|:..|:.....|::..:....||.:.|:..|. ..|:.|..|.:...|..|
plant    64 -------------CEISFKKCLGQFLLQQQEEIACVIYDEFMYFAE-AAAKEFNLPKVIFSTENA 114

  Fly   165 ISWNTDLVGSPSPPSYVPSALLKF--SDRMS-LVERVGNQAFLTYEYIFLNYFYLPRQ------- 219
            .::            ...||:.|.  .|.:: |.|..|.:..|..|...|.|..||..       
plant   115 TAF------------ACRSAMCKLYAKDGIAPLTEGCGREEELVPELHPLRYKDLPTSAFAPVEA 167

  Fly   220 --EVLYRKYFPNN--KQDFYDMRKNT-------ALVLLNQHVSLSFPRPYSPNMIEVGGMHINRK 273
              ||     |.::  |.....|..||       :|..|.|.:.:    |..|    :|.:::...
plant   168 SVEV-----FKSSCEKGTASSMIINTVSCLEISSLEWLQQELKI----PIYP----IGPLYMVSS 219

  Fly   274 RQPLPKDILEFIEGA--------EHGVIYFSMGS--NLKSKTLPLEKRQALIDTFAQLKQRVLWK 328
            ..  |..:|:..|..        ...|||.|:||  .|::|.: ||....|:.:    .|..||.
plant   220 AP--PTSLLDENESCIDWLNKQKPSSVIYISLGSFTLLETKEV-LEMASGLVSS----NQYFLWA 277

  Fly   329 FEDTDLPGK-------------PANVFISDWFPQDDILAHDNVLAFITHGGLLSTTESIYHRKPF 380
            .....:.|.             |...:|..|..|..:|||..|.||.:|.|..||.|||....|.
plant   278 IRPGSILGSELSNEELFSMMEIPDRGYIVKWATQKQVLAHAAVGAFWSHCGWNSTLESIGEGIPI 342

  Fly   381 VGI 383
            ||:
plant   343 VGL 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302C1NP_652626.1 egt <117..466 CDD:223071 75/311 (24%)
AT5G37950NP_198611.1 Glycosyltransferase_GTB_type 1..343 CDD:299143 88/389 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.