DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302C1 and UGT78D3

DIOPT Version :9

Sequence 1:NP_652626.1 Gene:Ugt302C1 / 53510 FlyBaseID:FBgn0040259 Length:528 Species:Drosophila melanogaster
Sequence 2:NP_197205.1 Gene:UGT78D3 / 831566 AraportID:AT5G17030 Length:459 Species:Arabidopsis thaliana


Alignment Length:393 Identity:75/393 - (19%)
Similarity:128/393 - (32%) Gaps:116/393 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 IKNIKD-VPAKSILTSMQGRIANLLQSSKEPIIKQIINFHEMGIEITELLLKEPSVIELMKSNQT 131
            :.|:.| ||...:||........|...:...|.::.|...|     ||:             .:.
plant    66 VHNVDDGVPEGFVLTGNPQHAVELFLEAAPEIFRREIKAAE-----TEV-------------GRK 112

  Fly   132 FDAVISEVFLNEAHFGFAEHFKAPLIGLGTFGAISWNTDLVGSPSPPSYVPS-----ALLKFSDR 191
            |..::::.||..|....|...||..:.....||.|....|        |..:     .:.:..:|
plant   113 FKCILTDAFLWLAAETAAAEMKASWVAYYGGGATSLTAHL--------YTDAIRENVGVKEVGER 169

  Fly   192 MSLVERVG---------------NQAFLTYEYIFLNYFY-----LPRQEVLYRKYF----PNNKQ 232
            |.  |.:|               ...|...:.:|....:     |||...::...|    |....
plant   170 ME--ETIGFISGMEKIRVKDTQEGVVFGNLDSVFSKTLHQMGLALPRATAVFINSFEELDPTFTN 232

  Fly   233 DFYDMRK---------------NTALVLLNQHVSLSFPRPYSPNMIEVGGMHINRKRQPLPKDIL 282
            ||....|               .|:.::.:.|..|::....|  ...|..:...|...|.|.:::
plant   233 DFRSEFKRYLNIGPLALLSSPSQTSTLVHDPHGCLAWIEKRS--TASVAYIAFGRVATPPPVELV 295

  Fly   283 EFIEGAEHGVIYFSMGSNLKSKTLPLEKRQALIDTFAQLKQRVLWKFEDTDLPGKPANV------ 341
            ...:|.|...:.|                              :|..::..:...|...      
plant   296 AIAQGLESSKVPF------------------------------VWSLQEMKMTHLPEGFLDRTRE 330

  Fly   342 --FISDWFPQDDILAHDNVLAFITHGGLLSTTESIYHRKPFVGIPIFGDQFLNMARAEQNGY--G 402
              .:..|.||.::|.|:.:..|::|||..|..||:....|.:..|||||..:| ||:.:..:  |
plant   331 QGMVVPWAPQVELLNHEAMGVFVSHGGWNSVLESVSAGVPMICRPIFGDHAIN-ARSVEAVWEIG 394

  Fly   403 VTV 405
            ||:
plant   395 VTI 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302C1NP_652626.1 egt <117..466 CDD:223071 63/343 (18%)
UGT78D3NP_197205.1 Glycosyltransferase_GTB_type 6..458 CDD:299143 75/393 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.