DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302C1 and UGT84A1

DIOPT Version :9

Sequence 1:NP_652626.1 Gene:Ugt302C1 / 53510 FlyBaseID:FBgn0040259 Length:528 Species:Drosophila melanogaster
Sequence 2:NP_193283.2 Gene:UGT84A1 / 827220 AraportID:AT4G15480 Length:490 Species:Arabidopsis thaliana


Alignment Length:242 Identity:62/242 - (25%)
Similarity:85/242 - (35%) Gaps:90/242 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 LEFIEG-AEHGVIYFSMGSNLKSKTLPLEKRQALIDTFAQLKQR---------------VLW--- 327
            ||:::. .:..|:|.|.|                  |.|.|||.               .||   
plant   278 LEWLDSRPKSSVVYISFG------------------TVAYLKQEQIEEIAHGVLKSGLSFLWVIR 324

  Fly   328 ------KFEDTDLP---------GKPANVFISDWFPQDDILAHDNVLAFITHGGLLSTTESIYHR 377
                  |.|...||         ||.   .|.||.||:.:|:|.:|..|:||.|..||.||:...
plant   325 PPPHDLKVETHVLPQELKESSAKGKG---MIVDWCPQEQVLSHPSVACFVTHCGWNSTMESLSSG 386

  Fly   378 KPFVGIPIFGDQFLN-------MARAEQNGYGVT----VHYEELSSAKLLAAIQKIINNPEATQR 431
            .|.|..|.:|||..:       .....:.|.|.|    |..||::. |||          |||  
plant   387 VPVVCCPQWGDQVTDAVYLIDVFKTGVRLGRGATEERVVPREEVAE-KLL----------EAT-- 438

  Fly   432 VRDMSDRYRDQQQTPLERAVYWVEHVSRHKGAKYLRSASQDLNFIQY 478
            |.:.::..|       :.|:.|.....    |......|.|.||.::
plant   439 VGEKAEELR-------KNALKWKAEAE----AAVAPGGSSDKNFREF 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302C1NP_652626.1 egt <117..466 CDD:223071 58/228 (25%)
UGT84A1NP_193283.2 PLN02555 17..490 CDD:178170 62/242 (26%)
YjiC 19..477 CDD:224732 62/242 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.