DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302C1 and AT3G55700

DIOPT Version :9

Sequence 1:NP_652626.1 Gene:Ugt302C1 / 53510 FlyBaseID:FBgn0040259 Length:528 Species:Drosophila melanogaster
Sequence 2:NP_191129.1 Gene:AT3G55700 / 824736 AraportID:AT3G55700 Length:460 Species:Arabidopsis thaliana


Alignment Length:300 Identity:66/300 - (22%)
Similarity:114/300 - (38%) Gaps:75/300 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 EVLYRKYFPNNKQDFYDMRKNTALVLLN----------QHVSLSFPRPYSPNMIEVGGMHINRKR 274
            |.|||..     .|..:..|:::.|:.|          .:.|.....|:.|    :|..| ....
plant   191 EELYRVV-----NDMVEGAKSSSGVIWNTFEDLERLSLMNCSSKLQVPFFP----IGPFH-KYSE 245

  Fly   275 QPLP----KDILEFIEGAE-HGVIYFSMGSNLKSKTLPLEKRQALIDTFAQLKQRVLWKFEDTDL 334
            .|.|    |:..::::..: ..|:|.|.||     ...:|:::.|         .:.|...:::.
plant   246 DPTPKTENKEDTDWLDKQDPQSVVYASFGS-----LAAIEEKEFL---------EIAWGLRNSER 296

  Fly   335 P----GKPANVFISDWFP---------------------QDDILAHDNVLAFITHGGLLSTTESI 374
            |    .:|.:|..::|..                     |.::|||..:.||.||.|..||.|||
plant   297 PFLWVVRPGSVRGTEWLESLPLGFMENIGDKGKIVKWANQLEVLAHPAIGAFWTHCGWNSTLESI 361

  Fly   375 YHRKPFVGIPIFGDQFLNMARAEQNGYGVTVHYEELSSAKLLAAIQKIINNPEATQRVRDMSDRY 439
            ....|.:....|.||.:| ||...:.:.|.:..|.....|  ..|:|::.:.     :.:..|..
plant   362 CEGVPMICTSCFTDQHVN-ARYIVDVWRVGMLLERSKMEK--KEIEKVLRSV-----MMEKGDGL 418

  Fly   440 RDQQQTPLERAVYWVEHVSRHKGAKYL-RSASQDLNFIQY 478
            |::.....|||.:.:.  .....:||| :..|..|:|..|
plant   419 RERSLKLKERADFCLS--KDGSSSKYLDKLVSHVLSFDSY 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302C1NP_652626.1 egt <117..466 CDD:223071 60/285 (21%)
AT3G55700NP_191129.1 Glycosyltransferase_GTB_type 1..450 CDD:299143 63/292 (22%)
YjiC 8..427 CDD:224732 56/267 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.