DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302C1 and UGT73C7

DIOPT Version :9

Sequence 1:NP_652626.1 Gene:Ugt302C1 / 53510 FlyBaseID:FBgn0040259 Length:528 Species:Drosophila melanogaster
Sequence 2:NP_190884.1 Gene:UGT73C7 / 824482 AraportID:AT3G53160 Length:490 Species:Arabidopsis thaliana


Alignment Length:471 Identity:96/471 - (20%)
Similarity:179/471 - (38%) Gaps:141/471 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 SKEPIIKQIINFHEMG-----IEITELLLKEPSV----------IELMKSNQTFDAVISEVFLNE 143
            |.:|:...:|.|...|     ::|:.||.:...|          :..:|::.:|.::.:.:.:.|
plant     3 SHDPLHFVVIPFMAQGHMIPLVDISRLLSQRQGVTVCIITTTQNVAKIKTSLSFSSLFATINIVE 67

  Fly   144 AHF-----GFAEHFKAPLIGLGTFGAISWNTDLVGS--------------PSPPSYVPSALLKFS 189
            ..|     |..|..:: |..|.:.|.:....|...|              |.|...:....|.|:
plant    68 VKFLSQQTGLPEGCES-LDMLASMGDMVKFFDAANSLEEQVEKAMEEMVQPRPSCIIGDMSLPFT 131

  Fly   190 DRMSLVERVGNQAFLTYEYIFLNYFYLPRQEVLYR------KYF--PN--NKQDFY--------- 235
            .|::...::....|..:....|....:.|:..:.:      :||  |.  :|.:|.         
plant   132 SRLAKKFKIPKLIFHGFSCFSLMSIQVVRESGILKMIESNDEYFDLPGLPDKVEFTKPQVSVLQP 196

  Fly   236 ---DMRKNTAL----------VLLN--QHVSLSFPRPY----SPNMIEVGGMHI-NR-------- 272
               :|:::||.          |::|  :.:.:.:.|.|    :..:..||.:.: ||        
plant   197 VEGNMKESTAKIIEADNDSYGVIVNTFEELEVDYAREYRKARAGKVWCVGPVSLCNRLGLDKAKR 261

  Fly   273 -KRQPLPKD-ILEFIEGAEHG-VIYFSMGSNLKSKTLPLEKRQALIDTFAQLKQ----------R 324
             .:..:.:| .|::::..|.| |:|..:||..   .|||          ||||:          .
plant   262 GDKASIGQDQCLQWLDSQETGSVLYVCLGSLC---NLPL----------AQLKELGLGLEASNKP 313

  Fly   325 VLWKFEDTDLPGKPAN---------------VFISDWFPQDDILAHDNVLAFITHGGLLSTTESI 374
            .:|...:....|..||               :.|..|.||..||:|.::..|:||.|..||.|.|
plant   314 FIWVIREWGKYGDLANWMQQSGFEERIKDRGLVIKGWAPQVFILSHASIGGFLTHCGWNSTLEGI 378

  Fly   375 YHRKPFVGIPIFGDQFLN---MARAEQNGYGVTVH-------YEELSSAKLLAAIQKII-----N 424
            ....|.:..|:|.:||||   :.:..:.|..:.|.       .||:.:......::|.:     :
plant   379 TAGVPLLTWPLFAEQFLNEKLVVQILKAGLKIGVEKLMKYGKEEEIGAMVSRECVRKAVDELMGD 443

  Fly   425 NPEATQR---VRDMSD 437
            :.||.:|   |.::||
plant   444 SEEAEERRRKVTELSD 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302C1NP_652626.1 egt <117..466 CDD:223071 88/443 (20%)
UGT73C7NP_190884.1 Glycosyltransferase_GTB_type 7..489 CDD:299143 94/467 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.