DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302C1 and AT3G46720

DIOPT Version :9

Sequence 1:NP_652626.1 Gene:Ugt302C1 / 53510 FlyBaseID:FBgn0040259 Length:528 Species:Drosophila melanogaster
Sequence 2:NP_190256.1 Gene:AT3G46720 / 823825 AraportID:AT3G46720 Length:447 Species:Arabidopsis thaliana


Alignment Length:244 Identity:61/244 - (25%)
Similarity:103/244 - (42%) Gaps:44/244 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 KNTALVLLNQHVSLSFPRPYSPNMIEVGGMHI----NRKRQPLPKDILEFIEGAE-HGVIYFSMG 298
            ::::|..|.|.:|:    |..|    :|.:||    |.......:..:|::...: ..|||.|:|
plant   215 ESSSLSWLKQELSI----PVYP----LGPLHITTSANFSLLEEDRSCIEWLNKQKLRSVIYISVG 271

  Fly   299 S--NLKSKTLPLEKRQALIDTFAQLKQRVLWKFEDTDLPG---KPANV--FISD------WFPQD 350
            |  ::::|.: ||....|.::    .|..||...    ||   .|..|  .:|:      |.||:
plant   272 SIAHMETKEV-LEMAWGLYNS----NQPFLWVIR----PGTESMPVEVSKIVSERGCIVKWAPQN 327

  Fly   351 DILAHDNVLAFITHGGLLSTTESIYHRKPFVGIPIFGDQFLNMARAEQNGYGVTVHYEELSSAKL 415
            ::|.|..|..|.:|.|..||.|||....|.:..|..|:|.||....|.......:...|:....:
plant   328 EVLVHPAVGGFWSHCGWNSTLESIVEGVPMICRPFNGEQKLNAMYIESVWRVGVLLQGEVERGCV 392

  Fly   416 LAAIQKIINNPEAT-QRVR--------DMSDRYRDQQQTPLERAVYWVE 455
            ..|::::|.:.|.. .|.|        :.|.|........|:..|:::|
plant   393 ERAVKRLIVDDEGVGMRERALVLKEKLNASVRSGGSSYNALDELVHYLE 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302C1NP_652626.1 egt <117..466 CDD:223071 61/244 (25%)
AT3G46720NP_190256.1 Glycosyltransferase_GTB_type 1..440 CDD:299143 60/241 (25%)
YjiC 7..447 CDD:224732 61/244 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.