DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302C1 and AT3G22250

DIOPT Version :10

Sequence 1:NP_652626.1 Gene:Ugt302C1 / 53510 FlyBaseID:FBgn0040259 Length:528 Species:Drosophila melanogaster
Sequence 2:NP_188864.1 Gene:AT3G22250 / 821795 AraportID:AT3G22250 Length:461 Species:Arabidopsis thaliana


Alignment Length:121 Identity:19/121 - (15%)
Similarity:47/121 - (38%) Gaps:22/121 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RNEAVHLAVSLVDRALPMF---------------NINKMRFQL-VGITSMRIAVKYEEIFPPILS 67
            |.:|:..|..:..|::|.|               :.:....|| ..:..:.:.:||.|   |:::
plant   506 RAQAIKAASHVDRRSMPAFGYMTHTVSAPSLHGKSADDTYLQLKKDLEYLDLKIKYNE---PLVN 567

  Fly    68 NTRHSFDGAILYWKVRLHRRNAHTILDRIM---LCTENELYKKDAECCQTPRAVAD 120
            ........:...::..::.....::.||.:   ...|:::..|.:..|:..|.:.|
plant   568 LVHSLLKNSTPGYRTSINVSGRESLKDRSLKPVRIAESDVDVKLSILCEQDRILQD 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302C1NP_652626.1 Glycosyltransferase_GTB-type <185..507 CDD:471961
AT3G22250NP_188864.1 PLN02562 1..461 CDD:215305
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.