DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302C1 and UGT71B6

DIOPT Version :9

Sequence 1:NP_652626.1 Gene:Ugt302C1 / 53510 FlyBaseID:FBgn0040259 Length:528 Species:Drosophila melanogaster
Sequence 2:NP_188815.2 Gene:UGT71B6 / 821732 AraportID:AT3G21780 Length:479 Species:Arabidopsis thaliana


Alignment Length:265 Identity:53/265 - (20%)
Similarity:103/265 - (38%) Gaps:63/265 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 DMRKNTALVLLNQHVSLSFPRPYSPNMIEVGGMHINRKRQPLPKDILEFI-EGAEHGVIYFSMGS 299
            |:.......|.|.::..::|.....::..|...::::|:    .:||.:: |.....|::...||
plant   215 DLEPQALTFLSNGNIPRAYPVGPLLHLKNVNCDYVDKKQ----SEILRWLDEQPPRSVVFLCFGS 275

  Fly   300 -------NLKSKTLPLEKRQALIDTFAQLKQRVLWKFEDT------DLPGK--------PANVF- 342
                   .::...|.|::.          ..|.||.....      :.||:        |...| 
plant   276 MGGFSEEQVRETALALDRS----------GHRFLWSLRRASPNILREPPGEFTNLEEILPEGFFD 330

  Fly   343 -------ISDWFPQDDILAHDNVLAFITHGGLLSTTESIYHRKPFVGIPIFGDQFLN-MARAEQN 399
                   :..|..|..|||...:..|::|||..||.||::...|....|::.:|..| ....|:.
plant   331 RTANRGKVIGWAEQVAILAKPAIGGFVSHGGWNSTLESLWFGVPMAIWPLYAEQKFNAFEMVEEL 395

  Fly   400 GYGVTV--HYEE---LSSAKLLAA--IQKII-----NNPEATQRVRDMSDRYR------DQQQTP 446
            |..|.:  |:..   |..::::.|  |:|.|     .:.:..:||.::|::..      ...:|.
plant   396 GLAVEIKKHWRGDLLLGRSEIVTAEEIEKGIICLMEQDSDVRKRVNEISEKCHVALMDGGSSETA 460

  Fly   447 LERAV 451
            |:|.:
plant   461 LKRFI 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302C1NP_652626.1 egt <117..466 CDD:223071 53/265 (20%)
UGT71B6NP_188815.2 PLN02554 1..473 CDD:215304 53/265 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.